Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6V7D7

Protein Details
Accession A0A5N6V7D7    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-49VLAKKHVPIVKKRTKTFKRHQSDRFKCVPESWRKPKGIDSRVRRRFKSHydrophilic
NLS Segment(s)
PositionSequence
12-20KKRTKTFKR
34-47RKPKGIDSRVRRRF
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVLAKKHVPIVKKRTKTFKRHQSDRFKCVPESWRKPKGIDSRVRRRFKSNIPMPSIGYGSNKKTKHMMPSGHKAFLVQNPKDVELLLMHNRTYADRPRRLLPQACRDHRQGQGSRCQGYQPQGPCHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.85
4 0.86
5 0.86
6 0.86
7 0.87
8 0.89
9 0.9
10 0.88
11 0.86
12 0.83
13 0.75
14 0.66
15 0.62
16 0.61
17 0.61
18 0.62
19 0.64
20 0.64
21 0.63
22 0.62
23 0.66
24 0.66
25 0.65
26 0.64
27 0.65
28 0.67
29 0.75
30 0.8
31 0.74
32 0.7
33 0.67
34 0.66
35 0.67
36 0.64
37 0.61
38 0.6
39 0.59
40 0.53
41 0.48
42 0.4
43 0.3
44 0.26
45 0.21
46 0.19
47 0.25
48 0.25
49 0.24
50 0.27
51 0.28
52 0.32
53 0.35
54 0.38
55 0.37
56 0.47
57 0.49
58 0.46
59 0.44
60 0.38
61 0.34
62 0.33
63 0.35
64 0.26
65 0.27
66 0.28
67 0.29
68 0.28
69 0.25
70 0.2
71 0.13
72 0.17
73 0.16
74 0.16
75 0.15
76 0.16
77 0.17
78 0.18
79 0.21
80 0.26
81 0.31
82 0.36
83 0.4
84 0.43
85 0.49
86 0.54
87 0.58
88 0.57
89 0.59
90 0.64
91 0.67
92 0.67
93 0.67
94 0.65
95 0.63
96 0.64
97 0.6
98 0.56
99 0.59
100 0.61
101 0.58
102 0.53
103 0.5
104 0.46
105 0.45
106 0.46
107 0.43