Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6UT07

Protein Details
Accession A0A5N6UT07    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
39-67VKFGRRSHCQESRKDKNRHRFLHRPASSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 6, golg 5, mito_nucl 5
Family & Domain DBs
Amino Acid Sequences MPYLSISRKLRRILFSFFVFFYFFFNPSLMISRGTSVTVKFGRRSHCQESRKDKNRHRFLHRPASSSEVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.5
3 0.45
4 0.39
5 0.35
6 0.29
7 0.24
8 0.21
9 0.18
10 0.15
11 0.14
12 0.14
13 0.13
14 0.13
15 0.15
16 0.12
17 0.12
18 0.11
19 0.11
20 0.12
21 0.12
22 0.12
23 0.09
24 0.13
25 0.15
26 0.17
27 0.2
28 0.23
29 0.28
30 0.34
31 0.41
32 0.45
33 0.51
34 0.55
35 0.61
36 0.68
37 0.74
38 0.77
39 0.8
40 0.82
41 0.83
42 0.88
43 0.87
44 0.86
45 0.85
46 0.84
47 0.85
48 0.8
49 0.73
50 0.65