Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6UYQ5

Protein Details
Accession A0A5N6UYQ5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-41LLWKIPWRISQPQKARQRKRLRSVDRVVDTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKASSPLFSGLLWKIPWRISQPQKARQRKRLRSVDRVVDTISAALARNGQKARSVDRWYREMPREEEMLPKDKYTLFDKKEKTYRKGIHSTLPLIVRLLQPFSTSNVTSLAWDVRTETRIEWEAGWWNM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.23
4 0.27
5 0.29
6 0.38
7 0.43
8 0.52
9 0.59
10 0.66
11 0.74
12 0.81
13 0.85
14 0.85
15 0.88
16 0.88
17 0.89
18 0.9
19 0.88
20 0.86
21 0.84
22 0.83
23 0.74
24 0.65
25 0.55
26 0.45
27 0.37
28 0.27
29 0.19
30 0.11
31 0.08
32 0.07
33 0.1
34 0.1
35 0.15
36 0.15
37 0.16
38 0.2
39 0.21
40 0.26
41 0.28
42 0.33
43 0.34
44 0.36
45 0.4
46 0.39
47 0.43
48 0.42
49 0.4
50 0.36
51 0.34
52 0.32
53 0.28
54 0.3
55 0.26
56 0.28
57 0.24
58 0.22
59 0.2
60 0.19
61 0.21
62 0.23
63 0.29
64 0.27
65 0.34
66 0.38
67 0.43
68 0.51
69 0.56
70 0.55
71 0.57
72 0.59
73 0.59
74 0.63
75 0.59
76 0.57
77 0.53
78 0.51
79 0.45
80 0.4
81 0.32
82 0.26
83 0.25
84 0.21
85 0.18
86 0.18
87 0.14
88 0.15
89 0.15
90 0.18
91 0.2
92 0.18
93 0.18
94 0.18
95 0.18
96 0.17
97 0.18
98 0.17
99 0.13
100 0.13
101 0.15
102 0.17
103 0.18
104 0.19
105 0.18
106 0.21
107 0.23
108 0.24
109 0.22
110 0.21