Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6UTZ4

Protein Details
Accession A0A5N6UTZ4    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
32-52IEPSKKSQHPYKGRRLCKAKLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 5.5, cyto_nucl 4.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR047092  YDR124W-like_helical  
Pfam View protein in Pfam  
PF11001  DUF2841  
Amino Acid Sequences MSLTFREVTMKYFQDLKQDFCSPLAKFLINIIEPSKKSQHPYKGRRLCKAKLVGPTWGSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.36
4 0.36
5 0.37
6 0.35
7 0.32
8 0.35
9 0.26
10 0.27
11 0.24
12 0.19
13 0.17
14 0.17
15 0.18
16 0.14
17 0.14
18 0.13
19 0.15
20 0.15
21 0.18
22 0.22
23 0.21
24 0.26
25 0.33
26 0.42
27 0.49
28 0.57
29 0.65
30 0.7
31 0.75
32 0.81
33 0.81
34 0.75
35 0.73
36 0.73
37 0.67
38 0.66
39 0.62
40 0.59