Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q74Z86

Protein Details
Accession Q74Z86    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
35-54VEMADDRRRKKKQYNHPELQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR010997  HRDC-like_sf  
IPR005574  Rpb4/RPC9  
IPR038324  Rpb4/RPC9_sf  
IPR038846  RPC9  
Gene Ontology GO:0005829  C:cytosol  
GO:0005666  C:RNA polymerase III complex  
GO:0000166  F:nucleotide binding  
GO:0001056  F:RNA polymerase III activity  
GO:0006386  P:termination of RNA polymerase III transcription  
GO:0006384  P:transcription initiation at RNA polymerase III promoter  
GO:0042797  P:tRNA transcription by RNA polymerase III  
KEGG ago:AGOS_AGR317C  -  
Pfam View protein in Pfam  
PF03874  RNA_pol_Rpb4  
Amino Acid Sequences MKVEATRDAFISDYEALQFMSHLQRKHQWVVDEDVEMADDRRRKKKQYNHPELQAITKDVVNYLTTNKNADPEEEQQAVKSGITRMNDEKFTTLMRTLNQFDLYKAEKLQLVNQLPVNIVHLYALVEECDSRFSEEQVSAIIDAITTACV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.11
5 0.11
6 0.1
7 0.18
8 0.22
9 0.22
10 0.26
11 0.33
12 0.39
13 0.45
14 0.46
15 0.4
16 0.39
17 0.44
18 0.41
19 0.35
20 0.3
21 0.24
22 0.2
23 0.17
24 0.15
25 0.13
26 0.15
27 0.2
28 0.29
29 0.35
30 0.42
31 0.51
32 0.6
33 0.68
34 0.75
35 0.8
36 0.78
37 0.78
38 0.75
39 0.66
40 0.6
41 0.49
42 0.39
43 0.29
44 0.22
45 0.17
46 0.13
47 0.13
48 0.1
49 0.09
50 0.11
51 0.13
52 0.13
53 0.15
54 0.15
55 0.17
56 0.16
57 0.17
58 0.18
59 0.17
60 0.21
61 0.21
62 0.21
63 0.18
64 0.19
65 0.18
66 0.14
67 0.12
68 0.09
69 0.11
70 0.12
71 0.15
72 0.17
73 0.19
74 0.2
75 0.2
76 0.19
77 0.17
78 0.17
79 0.16
80 0.14
81 0.13
82 0.13
83 0.16
84 0.18
85 0.19
86 0.21
87 0.2
88 0.19
89 0.22
90 0.23
91 0.21
92 0.19
93 0.19
94 0.18
95 0.19
96 0.22
97 0.26
98 0.25
99 0.27
100 0.27
101 0.27
102 0.25
103 0.24
104 0.23
105 0.15
106 0.13
107 0.1
108 0.09
109 0.08
110 0.08
111 0.08
112 0.06
113 0.06
114 0.07
115 0.07
116 0.09
117 0.09
118 0.13
119 0.14
120 0.15
121 0.18
122 0.18
123 0.18
124 0.17
125 0.18
126 0.13
127 0.13
128 0.12
129 0.08
130 0.08