Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6UTW6

Protein Details
Accession A0A5N6UTW6    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
139-165EETQPKETGSRKPKQKKKKIKLSFDEEBasic
NLS Segment(s)
PositionSequence
120-127PKKRKQAK
143-159PKETGSRKPKQKKKKIK
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSFKSKNLAYEAKEPAFLQRLRNQYGDPSGRLERPIARPRKLKDADDDDEPTYVDEESNEVISKEEYEALIRDSNKEVEDTGKGEPGQEQPISQDEGDNKASTAQEAPISKQNMAEIGGPKKRKQAKVIGEEEPSAEKEETQPKETGSRKPKQKKKKIKLSFDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.4
4 0.37
5 0.35
6 0.36
7 0.41
8 0.43
9 0.45
10 0.41
11 0.38
12 0.45
13 0.42
14 0.37
15 0.35
16 0.35
17 0.35
18 0.35
19 0.33
20 0.31
21 0.36
22 0.44
23 0.47
24 0.51
25 0.57
26 0.59
27 0.67
28 0.65
29 0.59
30 0.58
31 0.58
32 0.54
33 0.5
34 0.5
35 0.4
36 0.35
37 0.32
38 0.24
39 0.17
40 0.14
41 0.09
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.08
51 0.07
52 0.07
53 0.06
54 0.07
55 0.07
56 0.08
57 0.12
58 0.11
59 0.12
60 0.13
61 0.14
62 0.14
63 0.13
64 0.12
65 0.1
66 0.11
67 0.12
68 0.11
69 0.11
70 0.11
71 0.1
72 0.12
73 0.12
74 0.14
75 0.12
76 0.12
77 0.11
78 0.13
79 0.14
80 0.13
81 0.13
82 0.11
83 0.14
84 0.16
85 0.15
86 0.13
87 0.13
88 0.13
89 0.12
90 0.12
91 0.09
92 0.11
93 0.12
94 0.15
95 0.19
96 0.21
97 0.21
98 0.21
99 0.2
100 0.17
101 0.18
102 0.19
103 0.17
104 0.22
105 0.28
106 0.31
107 0.32
108 0.4
109 0.47
110 0.49
111 0.51
112 0.55
113 0.58
114 0.64
115 0.68
116 0.63
117 0.57
118 0.52
119 0.47
120 0.39
121 0.3
122 0.24
123 0.19
124 0.15
125 0.19
126 0.27
127 0.3
128 0.32
129 0.32
130 0.3
131 0.39
132 0.43
133 0.47
134 0.48
135 0.54
136 0.61
137 0.71
138 0.8
139 0.82
140 0.89
141 0.91
142 0.92
143 0.94
144 0.94
145 0.94