Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6V170

Protein Details
Accession A0A5N6V170    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
423-442QDAKRRATKMEGKNWFKWRKHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 8, mito 6, cyto 4, plas 3, E.R. 3, mito_nucl 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005502  Ribosyl_crysJ1  
IPR036705  Ribosyl_crysJ1_sf  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF03747  ADP_ribosyl_GH  
Amino Acid Sequences MDKLQISQDGWKRLARSCLHDSIVGCLVGSALGDAVGLYTEFLSGDMSATAYPVRKFVLSPETQATPFHRDSHRGPHRPGEWTDDTDHAMLLLFSCMHTDLKTLDPADFAARLHVWVQFGFLPLDTLPLGLGRTVGAIVRTKTYLDDPEATARRHWTNCQYNVAPNGSLMRTHPLGLVCLDKSLDETFDMAAAFSVVTHVDPRCVVSCAIGTALVRGLVLREVHTEANIDSMIDAAIHWYAKYRAQALQEHLERRDEPDLDVSELCRHAKVGDLNELELDDRYKMGYVYKTLGAGLHLLRLAMRDTANGMLTSRALAFEPLITDLIMRGGDADTNACFSGALLGAYLGYANLPLNWRNGLRHGSWLLGKAEGLSQMLGVADGEYVGSADKETARDGGRGGMPSQADMERKLMVLQAWMAEQEQDAKRRATKMEGKNWFKWRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.46
3 0.47
4 0.48
5 0.51
6 0.5
7 0.5
8 0.46
9 0.42
10 0.4
11 0.32
12 0.24
13 0.18
14 0.16
15 0.12
16 0.12
17 0.07
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.05
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.06
34 0.07
35 0.07
36 0.07
37 0.1
38 0.12
39 0.13
40 0.14
41 0.15
42 0.15
43 0.16
44 0.2
45 0.27
46 0.26
47 0.29
48 0.32
49 0.33
50 0.33
51 0.36
52 0.35
53 0.33
54 0.33
55 0.35
56 0.35
57 0.37
58 0.4
59 0.49
60 0.56
61 0.56
62 0.57
63 0.6
64 0.6
65 0.61
66 0.59
67 0.56
68 0.49
69 0.45
70 0.44
71 0.38
72 0.36
73 0.3
74 0.27
75 0.19
76 0.14
77 0.11
78 0.09
79 0.07
80 0.05
81 0.05
82 0.06
83 0.07
84 0.08
85 0.08
86 0.09
87 0.1
88 0.12
89 0.16
90 0.16
91 0.15
92 0.15
93 0.15
94 0.16
95 0.15
96 0.13
97 0.12
98 0.11
99 0.12
100 0.12
101 0.13
102 0.13
103 0.12
104 0.13
105 0.11
106 0.13
107 0.12
108 0.11
109 0.1
110 0.09
111 0.11
112 0.09
113 0.08
114 0.07
115 0.07
116 0.07
117 0.06
118 0.06
119 0.05
120 0.05
121 0.05
122 0.06
123 0.07
124 0.09
125 0.1
126 0.12
127 0.12
128 0.13
129 0.14
130 0.16
131 0.16
132 0.17
133 0.18
134 0.18
135 0.25
136 0.29
137 0.28
138 0.27
139 0.29
140 0.3
141 0.3
142 0.33
143 0.35
144 0.4
145 0.43
146 0.47
147 0.45
148 0.43
149 0.45
150 0.42
151 0.33
152 0.24
153 0.23
154 0.17
155 0.16
156 0.14
157 0.13
158 0.12
159 0.13
160 0.14
161 0.12
162 0.13
163 0.13
164 0.14
165 0.11
166 0.11
167 0.1
168 0.08
169 0.1
170 0.09
171 0.09
172 0.07
173 0.08
174 0.07
175 0.07
176 0.07
177 0.06
178 0.05
179 0.05
180 0.04
181 0.03
182 0.04
183 0.03
184 0.03
185 0.06
186 0.06
187 0.06
188 0.07
189 0.08
190 0.09
191 0.1
192 0.1
193 0.09
194 0.09
195 0.09
196 0.09
197 0.08
198 0.07
199 0.06
200 0.06
201 0.05
202 0.05
203 0.04
204 0.04
205 0.05
206 0.06
207 0.06
208 0.07
209 0.09
210 0.09
211 0.09
212 0.1
213 0.08
214 0.09
215 0.08
216 0.06
217 0.05
218 0.05
219 0.04
220 0.04
221 0.04
222 0.03
223 0.04
224 0.04
225 0.04
226 0.05
227 0.06
228 0.09
229 0.1
230 0.12
231 0.15
232 0.18
233 0.22
234 0.24
235 0.3
236 0.32
237 0.33
238 0.32
239 0.31
240 0.28
241 0.27
242 0.27
243 0.21
244 0.17
245 0.19
246 0.19
247 0.18
248 0.18
249 0.16
250 0.15
251 0.16
252 0.15
253 0.12
254 0.11
255 0.09
256 0.13
257 0.16
258 0.16
259 0.21
260 0.21
261 0.21
262 0.21
263 0.21
264 0.18
265 0.15
266 0.13
267 0.06
268 0.06
269 0.06
270 0.06
271 0.07
272 0.09
273 0.1
274 0.12
275 0.14
276 0.15
277 0.15
278 0.15
279 0.15
280 0.12
281 0.13
282 0.11
283 0.1
284 0.09
285 0.08
286 0.08
287 0.09
288 0.09
289 0.09
290 0.09
291 0.08
292 0.09
293 0.11
294 0.12
295 0.11
296 0.1
297 0.09
298 0.09
299 0.09
300 0.08
301 0.07
302 0.07
303 0.07
304 0.07
305 0.07
306 0.08
307 0.08
308 0.08
309 0.08
310 0.07
311 0.07
312 0.08
313 0.07
314 0.06
315 0.06
316 0.05
317 0.06
318 0.06
319 0.07
320 0.06
321 0.08
322 0.08
323 0.07
324 0.07
325 0.07
326 0.08
327 0.08
328 0.07
329 0.06
330 0.06
331 0.06
332 0.06
333 0.06
334 0.04
335 0.03
336 0.04
337 0.04
338 0.06
339 0.08
340 0.1
341 0.12
342 0.15
343 0.17
344 0.18
345 0.23
346 0.26
347 0.25
348 0.29
349 0.29
350 0.28
351 0.29
352 0.3
353 0.27
354 0.23
355 0.22
356 0.17
357 0.17
358 0.15
359 0.14
360 0.1
361 0.08
362 0.08
363 0.08
364 0.07
365 0.06
366 0.05
367 0.04
368 0.04
369 0.04
370 0.04
371 0.04
372 0.04
373 0.04
374 0.04
375 0.06
376 0.08
377 0.09
378 0.11
379 0.14
380 0.16
381 0.17
382 0.17
383 0.21
384 0.22
385 0.23
386 0.22
387 0.23
388 0.21
389 0.21
390 0.23
391 0.22
392 0.21
393 0.21
394 0.23
395 0.19
396 0.19
397 0.19
398 0.19
399 0.15
400 0.15
401 0.15
402 0.14
403 0.14
404 0.14
405 0.14
406 0.12
407 0.12
408 0.18
409 0.22
410 0.26
411 0.29
412 0.33
413 0.37
414 0.41
415 0.44
416 0.45
417 0.51
418 0.55
419 0.62
420 0.69
421 0.72
422 0.76