Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6V0B0

Protein Details
Accession A0A5N6V0B0    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
113-142QADRKKLMSRHRRPVRKRVRRVRTCNLPVEBasic
NLS Segment(s)
PositionSequence
116-133RKKLMSRHRRPVRKRVRR
Subcellular Location(s) nucl 12cyto_nucl 12, cyto 10, mito 3
Family & Domain DBs
Amino Acid Sequences MSAPLNEEHGLVSRPWTQRQIERVVEPRFHDYYREPRPHWELVGYRVHARCWELFSYHELGATAEEDLAIVLAELRERFKLGRQRKAGIPEMAAEDTVCTKCVSEAIGLALEQADRKKLMSRHRRPVRKRVRRVRTCNLPVEILYMIADYLPSQAIANIESAWGFSSGKTFWYSRIPTKIFHEVQDVAGEDLDWQRLCLNGKDGLRNPRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.35
4 0.38
5 0.43
6 0.49
7 0.53
8 0.5
9 0.53
10 0.56
11 0.55
12 0.55
13 0.51
14 0.51
15 0.46
16 0.42
17 0.4
18 0.37
19 0.42
20 0.48
21 0.52
22 0.48
23 0.52
24 0.57
25 0.56
26 0.52
27 0.48
28 0.4
29 0.37
30 0.42
31 0.37
32 0.37
33 0.35
34 0.34
35 0.31
36 0.31
37 0.27
38 0.24
39 0.24
40 0.19
41 0.2
42 0.23
43 0.24
44 0.21
45 0.2
46 0.16
47 0.15
48 0.14
49 0.13
50 0.1
51 0.06
52 0.05
53 0.05
54 0.04
55 0.04
56 0.03
57 0.02
58 0.02
59 0.03
60 0.04
61 0.04
62 0.06
63 0.06
64 0.07
65 0.08
66 0.14
67 0.24
68 0.31
69 0.4
70 0.43
71 0.46
72 0.49
73 0.54
74 0.53
75 0.44
76 0.37
77 0.29
78 0.27
79 0.23
80 0.2
81 0.14
82 0.09
83 0.1
84 0.09
85 0.09
86 0.06
87 0.06
88 0.06
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.06
95 0.05
96 0.05
97 0.05
98 0.04
99 0.05
100 0.05
101 0.06
102 0.06
103 0.07
104 0.12
105 0.16
106 0.27
107 0.37
108 0.46
109 0.56
110 0.66
111 0.76
112 0.77
113 0.84
114 0.85
115 0.85
116 0.87
117 0.86
118 0.88
119 0.88
120 0.91
121 0.89
122 0.88
123 0.83
124 0.78
125 0.68
126 0.58
127 0.48
128 0.41
129 0.32
130 0.21
131 0.15
132 0.09
133 0.07
134 0.06
135 0.06
136 0.04
137 0.04
138 0.04
139 0.05
140 0.05
141 0.06
142 0.06
143 0.07
144 0.07
145 0.07
146 0.07
147 0.06
148 0.07
149 0.07
150 0.07
151 0.07
152 0.06
153 0.09
154 0.09
155 0.11
156 0.14
157 0.14
158 0.15
159 0.23
160 0.28
161 0.32
162 0.41
163 0.41
164 0.41
165 0.47
166 0.54
167 0.48
168 0.45
169 0.44
170 0.36
171 0.35
172 0.34
173 0.29
174 0.2
175 0.18
176 0.16
177 0.12
178 0.12
179 0.15
180 0.12
181 0.11
182 0.11
183 0.15
184 0.18
185 0.19
186 0.22
187 0.25
188 0.29
189 0.37
190 0.43