Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6UTZ7

Protein Details
Accession A0A5N6UTZ7    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
51-73AGVSKKKSKTKGLTKAQRARQQKHydrophilic
NLS Segment(s)
PositionSequence
55-70KKKSKTKGLTKAQRAR
95-97RGK
Subcellular Location(s) nucl 14.5, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MAKARVQSKHSRAARRAASPSLDVDKSLTTLPRAEDTVIQRESILSDRANAGVSKKKSKTKGLTKAQRARQQKGIERAENIMDQLETKVEKSLKRGKTVKARRAEWEDLNRKSGATMFQNLNDEADNDDDDAMADVSTAPKKTKPQPQPTHVAQNPVADQHADIDVDDDIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.67
3 0.66
4 0.6
5 0.55
6 0.47
7 0.47
8 0.43
9 0.36
10 0.3
11 0.26
12 0.22
13 0.2
14 0.2
15 0.17
16 0.13
17 0.15
18 0.16
19 0.17
20 0.18
21 0.18
22 0.21
23 0.23
24 0.29
25 0.27
26 0.26
27 0.24
28 0.22
29 0.23
30 0.2
31 0.18
32 0.11
33 0.12
34 0.13
35 0.13
36 0.14
37 0.13
38 0.14
39 0.19
40 0.23
41 0.3
42 0.35
43 0.42
44 0.46
45 0.55
46 0.61
47 0.64
48 0.71
49 0.73
50 0.77
51 0.8
52 0.84
53 0.83
54 0.81
55 0.77
56 0.71
57 0.68
58 0.65
59 0.61
60 0.61
61 0.59
62 0.52
63 0.47
64 0.44
65 0.38
66 0.31
67 0.25
68 0.16
69 0.1
70 0.08
71 0.07
72 0.07
73 0.06
74 0.06
75 0.09
76 0.11
77 0.12
78 0.17
79 0.26
80 0.29
81 0.37
82 0.41
83 0.44
84 0.53
85 0.62
86 0.64
87 0.63
88 0.62
89 0.6
90 0.63
91 0.61
92 0.55
93 0.56
94 0.56
95 0.5
96 0.5
97 0.45
98 0.37
99 0.33
100 0.29
101 0.23
102 0.18
103 0.2
104 0.19
105 0.21
106 0.24
107 0.23
108 0.23
109 0.19
110 0.16
111 0.13
112 0.13
113 0.11
114 0.09
115 0.09
116 0.08
117 0.08
118 0.08
119 0.07
120 0.05
121 0.05
122 0.05
123 0.07
124 0.1
125 0.11
126 0.13
127 0.16
128 0.24
129 0.32
130 0.42
131 0.51
132 0.59
133 0.68
134 0.73
135 0.78
136 0.77
137 0.79
138 0.71
139 0.67
140 0.58
141 0.53
142 0.48
143 0.41
144 0.36
145 0.25
146 0.24
147 0.19
148 0.18
149 0.13
150 0.12
151 0.12