Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ULT7

Protein Details
Accession A0A5N6ULT7    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
40-67SFSRQQNSKGKWRGRKKKKDTSHGDIAVHydrophilic
NLS Segment(s)
PositionSequence
48-58KGKWRGRKKKK
Subcellular Location(s) plas 11, mito 4, nucl 3, golg 3, extr 2, E.R. 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MMTIFIFILNFCFLFLFLFCLFWRNIRCIEKKLVSLEPPSFSRQQNSKGKWRGRKKKKDTSHGDIAVGRLENQSPCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.11
4 0.09
5 0.11
6 0.11
7 0.13
8 0.13
9 0.17
10 0.19
11 0.17
12 0.23
13 0.29
14 0.32
15 0.33
16 0.4
17 0.38
18 0.39
19 0.4
20 0.36
21 0.32
22 0.31
23 0.29
24 0.25
25 0.24
26 0.25
27 0.24
28 0.22
29 0.25
30 0.25
31 0.33
32 0.4
33 0.43
34 0.49
35 0.55
36 0.63
37 0.68
38 0.76
39 0.78
40 0.8
41 0.87
42 0.87
43 0.89
44 0.91
45 0.92
46 0.9
47 0.87
48 0.85
49 0.76
50 0.69
51 0.59
52 0.5
53 0.43
54 0.34
55 0.27
56 0.18
57 0.19