Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6UHD6

Protein Details
Accession A0A5N6UHD6    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-40KAVSPQRHLRHKHRVRTDYKRVRVYRBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito_nucl 12.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences MTFTSSKRIPRLGLKAVSPQRHLRHKHRVRTDYKRVRVYRFSLQTKPIGKGTSQRHWLDRMQVIKSPERMGRRPSTTLILAYLCILEHVQSAETETTFSPGTEKKITN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.58
4 0.58
5 0.54
6 0.55
7 0.55
8 0.6
9 0.66
10 0.65
11 0.69
12 0.73
13 0.78
14 0.8
15 0.82
16 0.81
17 0.84
18 0.86
19 0.85
20 0.84
21 0.83
22 0.77
23 0.74
24 0.7
25 0.65
26 0.62
27 0.6
28 0.57
29 0.51
30 0.5
31 0.5
32 0.47
33 0.44
34 0.37
35 0.3
36 0.26
37 0.3
38 0.33
39 0.33
40 0.37
41 0.37
42 0.36
43 0.38
44 0.39
45 0.36
46 0.34
47 0.31
48 0.26
49 0.27
50 0.29
51 0.29
52 0.3
53 0.28
54 0.28
55 0.31
56 0.32
57 0.35
58 0.39
59 0.4
60 0.41
61 0.4
62 0.4
63 0.35
64 0.32
65 0.28
66 0.21
67 0.17
68 0.15
69 0.12
70 0.08
71 0.08
72 0.07
73 0.06
74 0.06
75 0.07
76 0.07
77 0.07
78 0.1
79 0.1
80 0.1
81 0.11
82 0.11
83 0.12
84 0.12
85 0.12
86 0.14
87 0.16
88 0.21