Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179UZM9

Protein Details
Accession A0A179UZM9    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
82-102SAPNAARRAIRRHCRPRCRPRBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9cysk 9, nucl 8, cyto 8
Family & Domain DBs
Amino Acid Sequences MEVQSELLSISEHEAISEYIIILENSDTSVMIDEAEFHYTASWSFTHTNDTYITSSLPFSWLSVKNIEDPSQKQKAALVSISAPNAARRAIRRHCRPRCRPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.11
5 0.08
6 0.07
7 0.08
8 0.07
9 0.06
10 0.06
11 0.06
12 0.06
13 0.06
14 0.05
15 0.05
16 0.06
17 0.05
18 0.05
19 0.05
20 0.06
21 0.07
22 0.08
23 0.08
24 0.07
25 0.07
26 0.07
27 0.08
28 0.08
29 0.07
30 0.08
31 0.1
32 0.1
33 0.15
34 0.15
35 0.16
36 0.15
37 0.17
38 0.15
39 0.14
40 0.14
41 0.1
42 0.1
43 0.09
44 0.09
45 0.07
46 0.07
47 0.12
48 0.14
49 0.15
50 0.17
51 0.18
52 0.2
53 0.22
54 0.25
55 0.24
56 0.26
57 0.32
58 0.36
59 0.35
60 0.31
61 0.32
62 0.31
63 0.3
64 0.27
65 0.21
66 0.18
67 0.2
68 0.2
69 0.19
70 0.17
71 0.16
72 0.16
73 0.16
74 0.18
75 0.21
76 0.3
77 0.39
78 0.49
79 0.58
80 0.68
81 0.78
82 0.85