Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6UTY1

Protein Details
Accession A0A5N6UTY1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-23LQLLRCRQLHKPPPNLNLSHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, mito 8, cyto_nucl 6.5, plas 3, cyto 2.5, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR017927  FAD-bd_FR_type  
IPR013121  Fe_red_NAD-bd_6  
IPR039261  FNR_nucleotide-bd  
Gene Ontology GO:0000293  F:ferric-chelate reductase activity  
Pfam View protein in Pfam  
PF08030  NAD_binding_6  
PROSITE View protein in PROSITE  
PS51384  FAD_FR  
CDD cd00322  FNR_like  
Amino Acid Sequences MRPLQLLRCRQLHKPPPNLNLSHKRHPSVIRHEMSSLASKKTSIPHKLRTAAEPRQNILYNVRLSHIEEVNPTVRLLHLTIPARVQALEESNQGEEEPDQPQPFTFAPGQWLDVHIPSISDAGGFSITSTPADAEALPSLQPTAESLAVEDEETGLPPVDPRGRDPYVELAVQKALSNPASAWLWKPKDDILGKELCIRVGGSFVWPPPSGIDLEKVKNVVLIAGGVGINPLISILSHLNNNADETPASHHPFNIHFLYSTKLPAAASQEAATSPEPVLDQILFLSRLRQIIHCQSQSHRLRITLDLFVTSLRDASSPLLLEQPEDLRIHPRRINQDDLRTALTGPNGDIQAEETVCYMCGPPAMTDEFVTTLRGLMGDGSDRVFFEKWW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.77
3 0.77
4 0.81
5 0.78
6 0.77
7 0.77
8 0.76
9 0.75
10 0.73
11 0.68
12 0.67
13 0.7
14 0.69
15 0.68
16 0.7
17 0.64
18 0.59
19 0.57
20 0.52
21 0.47
22 0.46
23 0.39
24 0.32
25 0.29
26 0.27
27 0.3
28 0.35
29 0.42
30 0.43
31 0.48
32 0.54
33 0.61
34 0.67
35 0.67
36 0.67
37 0.67
38 0.66
39 0.67
40 0.62
41 0.56
42 0.55
43 0.54
44 0.48
45 0.43
46 0.4
47 0.34
48 0.31
49 0.31
50 0.26
51 0.26
52 0.3
53 0.27
54 0.22
55 0.21
56 0.24
57 0.24
58 0.24
59 0.21
60 0.16
61 0.15
62 0.15
63 0.15
64 0.14
65 0.19
66 0.2
67 0.22
68 0.22
69 0.23
70 0.22
71 0.21
72 0.18
73 0.14
74 0.15
75 0.15
76 0.16
77 0.16
78 0.16
79 0.16
80 0.15
81 0.13
82 0.11
83 0.11
84 0.11
85 0.14
86 0.14
87 0.14
88 0.14
89 0.17
90 0.16
91 0.18
92 0.17
93 0.14
94 0.18
95 0.18
96 0.2
97 0.17
98 0.19
99 0.16
100 0.15
101 0.16
102 0.12
103 0.11
104 0.09
105 0.1
106 0.07
107 0.06
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.07
120 0.06
121 0.06
122 0.07
123 0.07
124 0.07
125 0.07
126 0.06
127 0.06
128 0.06
129 0.05
130 0.07
131 0.07
132 0.07
133 0.07
134 0.08
135 0.08
136 0.08
137 0.07
138 0.06
139 0.05
140 0.06
141 0.06
142 0.05
143 0.05
144 0.05
145 0.08
146 0.11
147 0.11
148 0.14
149 0.2
150 0.21
151 0.22
152 0.23
153 0.24
154 0.23
155 0.24
156 0.21
157 0.15
158 0.14
159 0.14
160 0.13
161 0.1
162 0.09
163 0.09
164 0.09
165 0.08
166 0.09
167 0.09
168 0.1
169 0.11
170 0.16
171 0.18
172 0.18
173 0.19
174 0.18
175 0.24
176 0.25
177 0.25
178 0.21
179 0.22
180 0.21
181 0.24
182 0.23
183 0.17
184 0.15
185 0.14
186 0.1
187 0.09
188 0.09
189 0.07
190 0.08
191 0.08
192 0.11
193 0.11
194 0.11
195 0.1
196 0.11
197 0.11
198 0.1
199 0.14
200 0.14
201 0.15
202 0.16
203 0.16
204 0.15
205 0.15
206 0.14
207 0.1
208 0.07
209 0.05
210 0.04
211 0.05
212 0.05
213 0.04
214 0.04
215 0.03
216 0.03
217 0.03
218 0.03
219 0.02
220 0.02
221 0.04
222 0.05
223 0.07
224 0.08
225 0.08
226 0.09
227 0.1
228 0.11
229 0.1
230 0.09
231 0.08
232 0.09
233 0.12
234 0.16
235 0.19
236 0.18
237 0.18
238 0.2
239 0.21
240 0.24
241 0.22
242 0.18
243 0.16
244 0.16
245 0.18
246 0.17
247 0.17
248 0.13
249 0.12
250 0.11
251 0.12
252 0.16
253 0.15
254 0.15
255 0.14
256 0.15
257 0.14
258 0.16
259 0.14
260 0.11
261 0.09
262 0.09
263 0.09
264 0.09
265 0.1
266 0.08
267 0.08
268 0.07
269 0.09
270 0.09
271 0.09
272 0.11
273 0.12
274 0.14
275 0.15
276 0.17
277 0.21
278 0.28
279 0.36
280 0.37
281 0.38
282 0.39
283 0.48
284 0.52
285 0.52
286 0.45
287 0.39
288 0.38
289 0.4
290 0.4
291 0.33
292 0.28
293 0.23
294 0.22
295 0.2
296 0.18
297 0.14
298 0.11
299 0.08
300 0.08
301 0.08
302 0.09
303 0.11
304 0.11
305 0.11
306 0.14
307 0.14
308 0.14
309 0.15
310 0.15
311 0.16
312 0.17
313 0.17
314 0.23
315 0.27
316 0.34
317 0.36
318 0.42
319 0.49
320 0.54
321 0.62
322 0.6
323 0.64
324 0.62
325 0.6
326 0.56
327 0.46
328 0.42
329 0.34
330 0.29
331 0.21
332 0.18
333 0.19
334 0.17
335 0.16
336 0.15
337 0.15
338 0.16
339 0.16
340 0.15
341 0.11
342 0.11
343 0.12
344 0.12
345 0.11
346 0.08
347 0.1
348 0.11
349 0.11
350 0.14
351 0.17
352 0.17
353 0.17
354 0.18
355 0.19
356 0.18
357 0.19
358 0.15
359 0.13
360 0.12
361 0.12
362 0.1
363 0.08
364 0.1
365 0.1
366 0.11
367 0.13
368 0.13
369 0.13
370 0.17