Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6UQE2

Protein Details
Accession A0A5N6UQE2    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-34KQTVSRKAKRGSSTPKRQRRRACDSCFKRKIQHydrophilic
NLS Segment(s)
PositionSequence
8-23RKAKRGSSTPKRQRRR
Subcellular Location(s) nucl 17.5, cyto_nucl 12, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MPKQTVSRKAKRGSSTPKRQRRRACDSCFKRKIQCDTEFPQCNWCKHHNLACTYSRLQTRTEARYVNDRVLQHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.8
4 0.84
5 0.86
6 0.89
7 0.89
8 0.88
9 0.87
10 0.86
11 0.84
12 0.84
13 0.83
14 0.85
15 0.82
16 0.76
17 0.72
18 0.68
19 0.67
20 0.63
21 0.6
22 0.54
23 0.52
24 0.57
25 0.53
26 0.47
27 0.48
28 0.44
29 0.41
30 0.4
31 0.4
32 0.37
33 0.38
34 0.44
35 0.42
36 0.42
37 0.46
38 0.44
39 0.45
40 0.41
41 0.41
42 0.39
43 0.35
44 0.32
45 0.34
46 0.38
47 0.39
48 0.42
49 0.4
50 0.38
51 0.46
52 0.48
53 0.46
54 0.44