Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6UBG2

Protein Details
Accession A0A5N6UBG2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
51-77LFSCLLQERERKKKRRKPAFLFSKIPDHydrophilic
NLS Segment(s)
PositionSequence
59-68RERKKKRRKP
Subcellular Location(s) nucl 8.5, cyto_nucl 6.5, mito 5, cyto 3.5, plas 3, pero 3, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MILSHHITSSFSLGNPKPEGPDQEATHHRTAPADAMHNKILPFLLVPSFLLFSCLLQERERKKKRRKPAFLFSKIPDLFFSHWPNHRKKYRRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.28
4 0.28
5 0.3
6 0.33
7 0.32
8 0.37
9 0.33
10 0.37
11 0.42
12 0.43
13 0.43
14 0.39
15 0.33
16 0.28
17 0.26
18 0.23
19 0.19
20 0.19
21 0.19
22 0.21
23 0.22
24 0.23
25 0.22
26 0.19
27 0.17
28 0.12
29 0.1
30 0.07
31 0.07
32 0.06
33 0.06
34 0.06
35 0.07
36 0.06
37 0.08
38 0.07
39 0.07
40 0.08
41 0.11
42 0.12
43 0.13
44 0.21
45 0.27
46 0.38
47 0.48
48 0.56
49 0.65
50 0.73
51 0.82
52 0.87
53 0.9
54 0.88
55 0.9
56 0.9
57 0.87
58 0.84
59 0.75
60 0.74
61 0.63
62 0.55
63 0.46
64 0.39
65 0.34
66 0.33
67 0.36
68 0.33
69 0.4
70 0.47
71 0.54
72 0.6
73 0.67