Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6V3U6

Protein Details
Accession A0A5N6V3U6    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
56-75ITTAATYEREKKKKEKKRCDBasic
NLS Segment(s)
PositionSequence
65-73EKKKKEKKR
Subcellular Location(s) mito 20.5, cyto_mito 11.5, nucl 3
Family & Domain DBs
Amino Acid Sequences MKLAAIPLLGFCLPCSSFPNISRLILSSSTVMAVCEGFHQTFAPSRGDSSKNSIRITTAATYEREKKKKEKKRCD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.19
4 0.24
5 0.25
6 0.29
7 0.28
8 0.28
9 0.27
10 0.24
11 0.22
12 0.17
13 0.17
14 0.13
15 0.11
16 0.11
17 0.1
18 0.09
19 0.07
20 0.06
21 0.05
22 0.05
23 0.07
24 0.06
25 0.06
26 0.07
27 0.07
28 0.1
29 0.11
30 0.12
31 0.11
32 0.13
33 0.17
34 0.19
35 0.2
36 0.25
37 0.3
38 0.33
39 0.34
40 0.32
41 0.3
42 0.29
43 0.31
44 0.25
45 0.22
46 0.2
47 0.22
48 0.26
49 0.34
50 0.43
51 0.47
52 0.51
53 0.59
54 0.67
55 0.75