Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6V3P4

Protein Details
Accession A0A5N6V3P4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27LNHNTVRKERKEKKKEREWTRFNSSRDBasic
NLS Segment(s)
PositionSequence
7-17RKERKEKKKER
Subcellular Location(s) nucl 20, cyto_nucl 13.5, mito 4
Family & Domain DBs
Amino Acid Sequences LNHNTVRKERKEKKKEREWTRFNSSRDNRGSLENVGMIPGDMGAKIEVQKLMVPERLELSTSELLAQHSNRLSYGTNC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.92
4 0.93
5 0.89
6 0.86
7 0.86
8 0.83
9 0.74
10 0.75
11 0.68
12 0.66
13 0.61
14 0.56
15 0.47
16 0.42
17 0.41
18 0.31
19 0.28
20 0.2
21 0.16
22 0.12
23 0.11
24 0.08
25 0.05
26 0.05
27 0.04
28 0.03
29 0.03
30 0.03
31 0.04
32 0.05
33 0.06
34 0.06
35 0.07
36 0.08
37 0.1
38 0.12
39 0.15
40 0.15
41 0.15
42 0.17
43 0.17
44 0.17
45 0.15
46 0.18
47 0.16
48 0.16
49 0.16
50 0.14
51 0.15
52 0.18
53 0.18
54 0.18
55 0.19
56 0.19
57 0.19
58 0.2