Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6UJE5

Protein Details
Accession A0A5N6UJE5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-21VENGRNKKEKGKNKGTPLFGHydrophilic
NLS Segment(s)
PositionSequence
9-11KEK
Subcellular Location(s) mito 19, cyto 4.5, cyto_nucl 3.833, cyto_pero 3.666
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVENGRNKKEKGKNKGTPLFGGYVPIVVGFLASREGLYRSLPWNSRLLLIHNMLSAWMLHLYRGVFCSVIFDYYCY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.77
4 0.7
5 0.62
6 0.54
7 0.43
8 0.36
9 0.26
10 0.18
11 0.14
12 0.11
13 0.09
14 0.06
15 0.06
16 0.03
17 0.03
18 0.04
19 0.04
20 0.04
21 0.05
22 0.06
23 0.07
24 0.07
25 0.09
26 0.1
27 0.14
28 0.16
29 0.17
30 0.18
31 0.18
32 0.2
33 0.2
34 0.21
35 0.21
36 0.21
37 0.19
38 0.17
39 0.17
40 0.14
41 0.13
42 0.1
43 0.07
44 0.08
45 0.07
46 0.07
47 0.1
48 0.1
49 0.11
50 0.12
51 0.12
52 0.1
53 0.1
54 0.14
55 0.13
56 0.15