Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179U818

Protein Details
Accession A0A179U818   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-39QIIKAREHCHRLKREKKKMFKSQMHFIIHydrophilic
NLS Segment(s)
PositionSequence
27-27K
Subcellular Location(s) mito 21, cyto 3, nucl 2
Family & Domain DBs
Amino Acid Sequences MSFLFKYSAVLQIIKAREHCHRLKREKKKMFKSQMHFIIQNIEKTALLSEYVNLLTTEMKPETADQKMQDFEIQVDLTKREQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.26
4 0.3
5 0.37
6 0.43
7 0.46
8 0.53
9 0.62
10 0.7
11 0.78
12 0.83
13 0.86
14 0.89
15 0.9
16 0.9
17 0.9
18 0.88
19 0.83
20 0.81
21 0.78
22 0.71
23 0.61
24 0.5
25 0.47
26 0.39
27 0.34
28 0.26
29 0.19
30 0.15
31 0.15
32 0.15
33 0.08
34 0.07
35 0.06
36 0.06
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.08
44 0.11
45 0.1
46 0.1
47 0.1
48 0.13
49 0.17
50 0.19
51 0.22
52 0.2
53 0.23
54 0.24
55 0.25
56 0.25
57 0.21
58 0.19
59 0.19
60 0.18
61 0.16
62 0.18