Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UD12

Protein Details
Accession A0A179UD12    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-23EFPGAKRVRREDLRSRRSSRSBasic
239-308LNPLTTKAPKSRKKPGKKRRIVLRRRLAATRTAEAAEREKRMRRNREKKIKKRLKEKEKKATLRDGRGEQBasic
NLS Segment(s)
PositionSequence
245-301KAPKSRKKPGKKRRIVLRRRLAATRTAEAAEREKRMRRNREKKIKKRLKEKEKKATL
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
KEGG bgh:BDBG_02179  -  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MFEFPGAKRVRREDLRSRRSSRSPSPPDSTAATYAANALRNIFSSVETYTPPTPKATHPEPDLEHIQDEEEEQEFEFRLFHVPPARAGKCVSEPTRGVKSRDESEGDHNDGPQQIDVKDAGIQKFRIKLRSPTPTANDGVGGFVVPFRGWEYYFSDPEWAKRKMAGDRIEARTVDLDTRQKQIFVDAAVSGETILEGAKKCAWPGCHLSWRVIHLQTTPSKTKSKVPSDSSQTKGVTLLNPLTTKAPKSRKKPGKKRRIVLRRRLAATRTAEAAEREKRMRRNREKKIKKRLKEKEKKATLRDGRGEQEGSAGREMMNNDRDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.78
3 0.81
4 0.81
5 0.8
6 0.8
7 0.8
8 0.78
9 0.78
10 0.77
11 0.75
12 0.75
13 0.69
14 0.63
15 0.59
16 0.53
17 0.44
18 0.36
19 0.29
20 0.22
21 0.23
22 0.23
23 0.21
24 0.18
25 0.18
26 0.17
27 0.17
28 0.19
29 0.16
30 0.14
31 0.14
32 0.15
33 0.15
34 0.15
35 0.18
36 0.21
37 0.22
38 0.23
39 0.24
40 0.25
41 0.28
42 0.35
43 0.37
44 0.39
45 0.39
46 0.44
47 0.43
48 0.46
49 0.45
50 0.38
51 0.34
52 0.27
53 0.25
54 0.19
55 0.17
56 0.14
57 0.11
58 0.1
59 0.09
60 0.1
61 0.09
62 0.09
63 0.08
64 0.07
65 0.1
66 0.1
67 0.13
68 0.18
69 0.19
70 0.24
71 0.32
72 0.32
73 0.31
74 0.31
75 0.31
76 0.3
77 0.36
78 0.34
79 0.3
80 0.31
81 0.35
82 0.43
83 0.44
84 0.42
85 0.4
86 0.42
87 0.4
88 0.42
89 0.39
90 0.33
91 0.36
92 0.38
93 0.36
94 0.32
95 0.29
96 0.27
97 0.25
98 0.23
99 0.17
100 0.14
101 0.1
102 0.11
103 0.11
104 0.1
105 0.13
106 0.15
107 0.16
108 0.17
109 0.19
110 0.2
111 0.26
112 0.28
113 0.3
114 0.3
115 0.35
116 0.39
117 0.46
118 0.48
119 0.47
120 0.48
121 0.46
122 0.44
123 0.38
124 0.31
125 0.22
126 0.18
127 0.13
128 0.09
129 0.06
130 0.05
131 0.05
132 0.04
133 0.04
134 0.05
135 0.06
136 0.06
137 0.08
138 0.12
139 0.15
140 0.16
141 0.16
142 0.19
143 0.18
144 0.22
145 0.26
146 0.24
147 0.21
148 0.22
149 0.25
150 0.26
151 0.32
152 0.32
153 0.32
154 0.37
155 0.4
156 0.4
157 0.36
158 0.33
159 0.26
160 0.23
161 0.18
162 0.15
163 0.17
164 0.17
165 0.21
166 0.21
167 0.2
168 0.2
169 0.2
170 0.18
171 0.13
172 0.12
173 0.08
174 0.08
175 0.08
176 0.08
177 0.06
178 0.05
179 0.04
180 0.03
181 0.03
182 0.04
183 0.05
184 0.06
185 0.08
186 0.08
187 0.09
188 0.12
189 0.13
190 0.16
191 0.22
192 0.26
193 0.32
194 0.33
195 0.35
196 0.34
197 0.35
198 0.36
199 0.31
200 0.26
201 0.21
202 0.25
203 0.28
204 0.31
205 0.33
206 0.32
207 0.35
208 0.36
209 0.42
210 0.46
211 0.5
212 0.52
213 0.54
214 0.58
215 0.62
216 0.68
217 0.63
218 0.59
219 0.51
220 0.43
221 0.39
222 0.33
223 0.26
224 0.21
225 0.2
226 0.18
227 0.18
228 0.19
229 0.21
230 0.21
231 0.23
232 0.29
233 0.38
234 0.43
235 0.5
236 0.61
237 0.68
238 0.77
239 0.85
240 0.88
241 0.89
242 0.91
243 0.92
244 0.92
245 0.93
246 0.92
247 0.91
248 0.91
249 0.88
250 0.82
251 0.78
252 0.69
253 0.66
254 0.6
255 0.52
256 0.43
257 0.36
258 0.33
259 0.3
260 0.35
261 0.32
262 0.33
263 0.36
264 0.41
265 0.49
266 0.58
267 0.67
268 0.71
269 0.77
270 0.83
271 0.88
272 0.93
273 0.94
274 0.96
275 0.95
276 0.94
277 0.94
278 0.94
279 0.94
280 0.94
281 0.94
282 0.93
283 0.94
284 0.93
285 0.88
286 0.88
287 0.86
288 0.84
289 0.8
290 0.75
291 0.68
292 0.63
293 0.58
294 0.46
295 0.44
296 0.38
297 0.33
298 0.29
299 0.25
300 0.2
301 0.22
302 0.25
303 0.26