Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UHZ4

Protein Details
Accession A0A179UHZ4   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-25SDTGSRVKKGHSKRNTNRDSFFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 11, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MMTSDTGSRVKKGHSKRNTNRDSFFSFAFVKTGREEEKSLSIRRRINLIYYHFSIQLPSSILRHGPWRELKTSRSLSPEVQRAKLEIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.67
3 0.74
4 0.83
5 0.86
6 0.83
7 0.77
8 0.72
9 0.67
10 0.58
11 0.48
12 0.4
13 0.33
14 0.27
15 0.25
16 0.2
17 0.16
18 0.15
19 0.17
20 0.16
21 0.17
22 0.18
23 0.18
24 0.24
25 0.26
26 0.29
27 0.31
28 0.35
29 0.35
30 0.35
31 0.37
32 0.3
33 0.3
34 0.31
35 0.31
36 0.3
37 0.29
38 0.29
39 0.27
40 0.26
41 0.23
42 0.18
43 0.15
44 0.12
45 0.11
46 0.11
47 0.11
48 0.12
49 0.12
50 0.19
51 0.19
52 0.24
53 0.31
54 0.34
55 0.39
56 0.42
57 0.44
58 0.46
59 0.49
60 0.46
61 0.44
62 0.43
63 0.43
64 0.48
65 0.54
66 0.5
67 0.49
68 0.46