Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UW14

Protein Details
Accession A0A179UW14    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
288-317SGSITKKKKLNTPKKYSGKKPTPPSKLKIGHydrophilic
NLS Segment(s)
PositionSequence
293-313KKKKLNTPKKYSGKKPTPPSK
372-374KLK
Subcellular Location(s) nucl 22, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013246  SAGA_su_Sgf11  
Gene Ontology GO:0005634  C:nucleus  
GO:0070461  C:SAGA-type complex  
GO:0046872  F:metal ion binding  
KEGG bgh:BDBG_06911  -  
Pfam View protein in Pfam  
PF08209  Sgf11  
Amino Acid Sequences MAGTADANNDIPSATMSKLIRSVLDDTFYNIIHDIVAKVHREEKIARMRSAVVLAKKLGEEEASRLQANDLVAPESGSVEPGATAPSSVKQKDHDPVRVETDGATYDSGKVYLKGNPFQVTKEILCPNCRLPRLLYPLSGIGSRPPPDPYKEYCKKHPPIIMPGHDVHGNPFATDKINRKRKQQPQQQTSSNTPASSPPSTPSTPSNSFKHVVAEKISFPTVKCPNCPRYFVVTRVAQHLDRCLGLSGRQTKRNLTPMDNGTNTPAPPPMKPSTLKRALPSGDDDAASGSITKKKKLNTPKKYSGKKPTPPSKLKIGTTPDMAAAMDIPDSTPTSAGGGGDIDAASTTTTTTTVTTTSSKKKLNPTEGKQGKLKAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.16
3 0.16
4 0.19
5 0.22
6 0.22
7 0.22
8 0.23
9 0.27
10 0.22
11 0.25
12 0.23
13 0.23
14 0.24
15 0.23
16 0.21
17 0.17
18 0.15
19 0.12
20 0.13
21 0.1
22 0.12
23 0.16
24 0.17
25 0.19
26 0.24
27 0.26
28 0.29
29 0.31
30 0.36
31 0.43
32 0.47
33 0.45
34 0.42
35 0.42
36 0.4
37 0.43
38 0.39
39 0.32
40 0.29
41 0.29
42 0.28
43 0.26
44 0.25
45 0.2
46 0.17
47 0.15
48 0.17
49 0.22
50 0.23
51 0.23
52 0.22
53 0.22
54 0.22
55 0.22
56 0.19
57 0.14
58 0.13
59 0.12
60 0.12
61 0.12
62 0.11
63 0.11
64 0.09
65 0.08
66 0.07
67 0.07
68 0.07
69 0.08
70 0.06
71 0.06
72 0.07
73 0.11
74 0.18
75 0.19
76 0.21
77 0.23
78 0.28
79 0.36
80 0.42
81 0.44
82 0.42
83 0.44
84 0.48
85 0.45
86 0.4
87 0.32
88 0.27
89 0.21
90 0.18
91 0.15
92 0.1
93 0.1
94 0.1
95 0.11
96 0.1
97 0.1
98 0.11
99 0.15
100 0.19
101 0.21
102 0.24
103 0.28
104 0.28
105 0.29
106 0.29
107 0.28
108 0.25
109 0.27
110 0.29
111 0.27
112 0.29
113 0.3
114 0.34
115 0.37
116 0.37
117 0.33
118 0.3
119 0.36
120 0.41
121 0.4
122 0.35
123 0.3
124 0.3
125 0.29
126 0.27
127 0.19
128 0.14
129 0.16
130 0.17
131 0.17
132 0.18
133 0.2
134 0.24
135 0.28
136 0.3
137 0.37
138 0.44
139 0.48
140 0.53
141 0.61
142 0.61
143 0.62
144 0.63
145 0.56
146 0.56
147 0.58
148 0.52
149 0.46
150 0.42
151 0.38
152 0.34
153 0.3
154 0.22
155 0.2
156 0.17
157 0.13
158 0.13
159 0.12
160 0.13
161 0.16
162 0.23
163 0.28
164 0.39
165 0.42
166 0.5
167 0.59
168 0.67
169 0.75
170 0.77
171 0.78
172 0.76
173 0.8
174 0.77
175 0.71
176 0.65
177 0.6
178 0.5
179 0.39
180 0.32
181 0.27
182 0.25
183 0.23
184 0.19
185 0.16
186 0.2
187 0.2
188 0.21
189 0.22
190 0.25
191 0.28
192 0.32
193 0.33
194 0.32
195 0.33
196 0.31
197 0.33
198 0.27
199 0.24
200 0.22
201 0.21
202 0.19
203 0.19
204 0.2
205 0.16
206 0.15
207 0.2
208 0.25
209 0.25
210 0.29
211 0.34
212 0.42
213 0.45
214 0.48
215 0.44
216 0.45
217 0.47
218 0.45
219 0.44
220 0.39
221 0.37
222 0.38
223 0.37
224 0.3
225 0.28
226 0.27
227 0.22
228 0.18
229 0.17
230 0.14
231 0.12
232 0.12
233 0.18
234 0.25
235 0.29
236 0.35
237 0.36
238 0.4
239 0.45
240 0.51
241 0.48
242 0.43
243 0.45
244 0.44
245 0.48
246 0.45
247 0.4
248 0.36
249 0.34
250 0.3
251 0.24
252 0.24
253 0.19
254 0.19
255 0.24
256 0.24
257 0.27
258 0.31
259 0.37
260 0.42
261 0.49
262 0.51
263 0.47
264 0.5
265 0.46
266 0.44
267 0.43
268 0.37
269 0.29
270 0.27
271 0.24
272 0.19
273 0.18
274 0.15
275 0.12
276 0.1
277 0.15
278 0.17
279 0.22
280 0.25
281 0.29
282 0.39
283 0.49
284 0.59
285 0.63
286 0.71
287 0.78
288 0.84
289 0.89
290 0.89
291 0.89
292 0.88
293 0.86
294 0.87
295 0.87
296 0.87
297 0.86
298 0.8
299 0.8
300 0.76
301 0.69
302 0.66
303 0.63
304 0.56
305 0.51
306 0.47
307 0.37
308 0.31
309 0.28
310 0.2
311 0.14
312 0.1
313 0.07
314 0.06
315 0.06
316 0.07
317 0.08
318 0.09
319 0.09
320 0.08
321 0.09
322 0.1
323 0.1
324 0.09
325 0.08
326 0.08
327 0.08
328 0.08
329 0.06
330 0.06
331 0.06
332 0.06
333 0.05
334 0.06
335 0.05
336 0.06
337 0.07
338 0.08
339 0.08
340 0.09
341 0.12
342 0.17
343 0.23
344 0.32
345 0.39
346 0.44
347 0.5
348 0.59
349 0.67
350 0.73
351 0.76
352 0.75
353 0.79
354 0.79
355 0.78
356 0.74