Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6V4I7

Protein Details
Accession A0A5N6V4I7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
10-34LWISEGKRTPRKLRRRILWRLPILTHydrophilic
NLS Segment(s)
PositionSequence
17-25RTPRKLRRR
Subcellular Location(s) mito 23.5, mito_nucl 13
Family & Domain DBs
Amino Acid Sequences MRSLFSFCLLWISEGKRTPRKLRRRILWRLPILTLSMDGLVTVQMWCGGRKPRNLRLEQKPSNYYPSTRPESLAKPVMYSAGHAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.36
3 0.41
4 0.47
5 0.56
6 0.62
7 0.7
8 0.74
9 0.79
10 0.82
11 0.84
12 0.87
13 0.87
14 0.86
15 0.8
16 0.72
17 0.63
18 0.54
19 0.45
20 0.34
21 0.24
22 0.15
23 0.1
24 0.07
25 0.06
26 0.05
27 0.04
28 0.04
29 0.04
30 0.03
31 0.05
32 0.05
33 0.06
34 0.09
35 0.16
36 0.2
37 0.28
38 0.36
39 0.43
40 0.51
41 0.57
42 0.63
43 0.66
44 0.73
45 0.72
46 0.71
47 0.67
48 0.61
49 0.62
50 0.55
51 0.47
52 0.43
53 0.43
54 0.44
55 0.4
56 0.4
57 0.39
58 0.41
59 0.45
60 0.46
61 0.39
62 0.34
63 0.33
64 0.33
65 0.28