Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6V1Q0

Protein Details
Accession A0A5N6V1Q0    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MASANRISRRRAPRKMGGRRRNLPKSFTPHydrophilic
NLS Segment(s)
PositionSequence
7-31ISRRRAPRKMGGRRRNLPKSFTPPK
Subcellular Location(s) mito 19, nucl 4.5, cyto_nucl 4.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018744  DUF2293  
Pfam View protein in Pfam  
PF10056  DUF2293  
Amino Acid Sequences MASANRISRRRAPRKMGGRRRNLPKSFTPPKSPQSILAQARRNSLTSRRGRGGLFGAGSSNRISRAERKVGGRTSKYSKFGLIPRSTEPFEKNCFEKEPFATGYVFVPKGDVYVTRNCRTNTKESERTVYTVFDKTGKRTLGIRVPSDIYAAVLESAAATAETRANAVKLRDEKDLAHSRRILRTQFPLMPAESLEAILNHAFLKGSGRVGRTGTKSDERKADLAVEAHIRHMHTPYESMLHAGAGREEARNAVWELVKAIKTAWEGGDSQPMDVLALRNRMVESN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.89
3 0.9
4 0.89
5 0.89
6 0.89
7 0.91
8 0.91
9 0.86
10 0.81
11 0.79
12 0.78
13 0.78
14 0.75
15 0.73
16 0.7
17 0.7
18 0.71
19 0.63
20 0.59
21 0.56
22 0.59
23 0.58
24 0.58
25 0.61
26 0.56
27 0.59
28 0.56
29 0.5
30 0.45
31 0.45
32 0.46
33 0.46
34 0.51
35 0.49
36 0.5
37 0.49
38 0.48
39 0.44
40 0.37
41 0.29
42 0.23
43 0.21
44 0.18
45 0.19
46 0.17
47 0.14
48 0.12
49 0.13
50 0.16
51 0.22
52 0.29
53 0.35
54 0.39
55 0.42
56 0.48
57 0.53
58 0.58
59 0.54
60 0.53
61 0.53
62 0.55
63 0.54
64 0.48
65 0.44
66 0.41
67 0.42
68 0.45
69 0.41
70 0.38
71 0.37
72 0.41
73 0.4
74 0.37
75 0.35
76 0.31
77 0.32
78 0.32
79 0.31
80 0.29
81 0.31
82 0.3
83 0.31
84 0.28
85 0.28
86 0.26
87 0.25
88 0.23
89 0.19
90 0.19
91 0.18
92 0.17
93 0.12
94 0.12
95 0.1
96 0.1
97 0.1
98 0.1
99 0.1
100 0.18
101 0.24
102 0.26
103 0.31
104 0.31
105 0.36
106 0.38
107 0.43
108 0.43
109 0.46
110 0.5
111 0.47
112 0.51
113 0.48
114 0.45
115 0.39
116 0.32
117 0.26
118 0.2
119 0.19
120 0.19
121 0.19
122 0.19
123 0.24
124 0.23
125 0.21
126 0.22
127 0.25
128 0.26
129 0.28
130 0.26
131 0.23
132 0.23
133 0.22
134 0.21
135 0.17
136 0.11
137 0.08
138 0.07
139 0.05
140 0.04
141 0.04
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.04
149 0.04
150 0.05
151 0.05
152 0.06
153 0.08
154 0.09
155 0.14
156 0.18
157 0.2
158 0.22
159 0.23
160 0.23
161 0.29
162 0.39
163 0.36
164 0.36
165 0.37
166 0.38
167 0.42
168 0.46
169 0.4
170 0.34
171 0.37
172 0.38
173 0.36
174 0.36
175 0.32
176 0.28
177 0.26
178 0.22
179 0.18
180 0.13
181 0.11
182 0.09
183 0.07
184 0.08
185 0.07
186 0.07
187 0.06
188 0.06
189 0.06
190 0.06
191 0.09
192 0.09
193 0.13
194 0.15
195 0.16
196 0.18
197 0.2
198 0.25
199 0.25
200 0.28
201 0.3
202 0.35
203 0.38
204 0.41
205 0.45
206 0.43
207 0.41
208 0.39
209 0.35
210 0.29
211 0.26
212 0.23
213 0.22
214 0.19
215 0.19
216 0.2
217 0.19
218 0.18
219 0.19
220 0.19
221 0.16
222 0.17
223 0.17
224 0.18
225 0.17
226 0.17
227 0.15
228 0.14
229 0.13
230 0.12
231 0.11
232 0.11
233 0.12
234 0.12
235 0.12
236 0.12
237 0.12
238 0.14
239 0.15
240 0.15
241 0.15
242 0.15
243 0.17
244 0.21
245 0.21
246 0.19
247 0.18
248 0.19
249 0.19
250 0.21
251 0.2
252 0.17
253 0.18
254 0.2
255 0.28
256 0.24
257 0.23
258 0.21
259 0.2
260 0.18
261 0.18
262 0.2
263 0.16
264 0.2
265 0.21
266 0.22