Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6UEQ8

Protein Details
Accession A0A5N6UEQ8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
90-114AAWPCRERRNACKIRKYRNHLSGNTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 11, cyto 2
Family & Domain DBs
Amino Acid Sequences MKITTFTVLVFTFLSVSHAGVPPAGGGAKPVLPPLAHAVTEELEVYDGECLLADQKTSTYGICVAQAKSLPASPVKSKQNKIDFQWGCDAAWPCRERRNACKIRKYRNHLSGNTIWNARCH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.1
4 0.11
5 0.12
6 0.12
7 0.11
8 0.11
9 0.09
10 0.09
11 0.09
12 0.06
13 0.06
14 0.07
15 0.09
16 0.09
17 0.1
18 0.1
19 0.1
20 0.11
21 0.15
22 0.16
23 0.14
24 0.14
25 0.15
26 0.14
27 0.14
28 0.13
29 0.08
30 0.07
31 0.06
32 0.06
33 0.05
34 0.04
35 0.04
36 0.03
37 0.03
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.09
50 0.11
51 0.1
52 0.11
53 0.11
54 0.11
55 0.11
56 0.11
57 0.1
58 0.1
59 0.13
60 0.15
61 0.22
62 0.31
63 0.37
64 0.41
65 0.48
66 0.55
67 0.57
68 0.58
69 0.61
70 0.53
71 0.49
72 0.51
73 0.43
74 0.34
75 0.34
76 0.33
77 0.24
78 0.3
79 0.29
80 0.26
81 0.32
82 0.4
83 0.41
84 0.48
85 0.57
86 0.6
87 0.68
88 0.76
89 0.78
90 0.82
91 0.86
92 0.87
93 0.86
94 0.86
95 0.85
96 0.77
97 0.76
98 0.72
99 0.68
100 0.64
101 0.57