Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q753X8

Protein Details
Accession Q753X8    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKKRASNGRNKKGRGHVKPVRCVNCHydrophilic
83-114IVRVRSREDRRIRTPPQRQRFNRENRVNPADAHydrophilic
NLS Segment(s)
PositionSequence
3-18KKRASNGRNKKGRGHV
Subcellular Location(s) nucl 13, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003729  F:mRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ago:AGOS_AFR194W  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRASNGRNKKGRGHVKPVRCVNCSKCVPKDKAIKRMTIRNIVEAAAIRDLSEASVYAEYALPKTYNKLHYCVSCAIHARIVRVRSREDRRIRTPPQRQRFNRENRVNPADAAKKAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.76
6 0.81
7 0.82
8 0.78
9 0.7
10 0.69
11 0.63
12 0.63
13 0.61
14 0.58
15 0.57
16 0.6
17 0.61
18 0.63
19 0.68
20 0.66
21 0.7
22 0.67
23 0.66
24 0.61
25 0.65
26 0.62
27 0.61
28 0.54
29 0.46
30 0.44
31 0.36
32 0.33
33 0.24
34 0.2
35 0.12
36 0.11
37 0.08
38 0.07
39 0.07
40 0.06
41 0.05
42 0.04
43 0.04
44 0.05
45 0.04
46 0.05
47 0.06
48 0.06
49 0.06
50 0.07
51 0.06
52 0.07
53 0.09
54 0.13
55 0.2
56 0.21
57 0.24
58 0.27
59 0.27
60 0.3
61 0.32
62 0.29
63 0.24
64 0.26
65 0.24
66 0.25
67 0.24
68 0.24
69 0.25
70 0.27
71 0.29
72 0.29
73 0.34
74 0.39
75 0.47
76 0.54
77 0.59
78 0.64
79 0.67
80 0.73
81 0.76
82 0.78
83 0.81
84 0.82
85 0.83
86 0.85
87 0.84
88 0.84
89 0.85
90 0.85
91 0.85
92 0.85
93 0.82
94 0.81
95 0.81
96 0.73
97 0.65
98 0.62
99 0.57