Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179U9T1

Protein Details
Accession A0A179U9T1   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
55-76KRDFKMIIISDKKKKKKKKNEKBasic
NLS Segment(s)
PositionSequence
65-76DKKKKKKKKNEK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 3
Family & Domain DBs
Amino Acid Sequences MIQNIKKTALLSEHVNLFITEMKSETADQKMQDFEMQIDLAEKKQQKPFSEKTVKRDFKMIIISDKKKKKKKKNEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.21
4 0.18
5 0.19
6 0.16
7 0.13
8 0.11
9 0.11
10 0.12
11 0.13
12 0.15
13 0.14
14 0.15
15 0.15
16 0.16
17 0.16
18 0.16
19 0.16
20 0.14
21 0.11
22 0.1
23 0.09
24 0.07
25 0.08
26 0.08
27 0.08
28 0.12
29 0.14
30 0.17
31 0.23
32 0.28
33 0.3
34 0.37
35 0.42
36 0.47
37 0.56
38 0.56
39 0.58
40 0.65
41 0.67
42 0.6
43 0.61
44 0.52
45 0.45
46 0.48
47 0.42
48 0.4
49 0.45
50 0.51
51 0.55
52 0.64
53 0.7
54 0.74
55 0.82
56 0.84