Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6USZ8

Protein Details
Accession A0A5N6USZ8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
53-75SDVYVRSSNRRRDRRLSASKEYLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 11.833, cyto 9, cyto_nucl 5.833, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLHILNFGATVRSLQPWVHMRLENSRFPNRICRVVKIYLGVTFGMALHLYFISDVYVRSSNRRRDRRLSASKEYLGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.18
3 0.22
4 0.27
5 0.29
6 0.3
7 0.3
8 0.38
9 0.43
10 0.43
11 0.43
12 0.45
13 0.42
14 0.42
15 0.49
16 0.43
17 0.48
18 0.43
19 0.41
20 0.41
21 0.41
22 0.41
23 0.33
24 0.3
25 0.22
26 0.21
27 0.16
28 0.11
29 0.09
30 0.08
31 0.06
32 0.06
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.05
41 0.06
42 0.08
43 0.13
44 0.14
45 0.22
46 0.3
47 0.4
48 0.5
49 0.6
50 0.64
51 0.69
52 0.78
53 0.8
54 0.83
55 0.82
56 0.8
57 0.78