Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6V0W2

Protein Details
Accession A0A5N6V0W2    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPSPGRRKKKGAVKKPRENFHLQWBasic
NLS Segment(s)
PositionSequence
5-17GRRKKKGAVKKPR
Subcellular Location(s) mito 15, mito_nucl 13.333, nucl 9.5, cyto_nucl 6.166
Family & Domain DBs
Amino Acid Sequences MPSPGRRKKKGAVKKPRENFHLQWIPAFTDGSDGPVRIHMAHLNQPISTCNRQANFWSFSRTRINRAESGMRLHQHRSFPNMNNNKNKIITSEASQGKSKIFGGGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.91
3 0.89
4 0.85
5 0.82
6 0.73
7 0.72
8 0.69
9 0.58
10 0.52
11 0.45
12 0.4
13 0.33
14 0.3
15 0.19
16 0.14
17 0.13
18 0.14
19 0.13
20 0.12
21 0.11
22 0.13
23 0.13
24 0.11
25 0.12
26 0.1
27 0.12
28 0.17
29 0.2
30 0.2
31 0.19
32 0.19
33 0.2
34 0.23
35 0.22
36 0.19
37 0.19
38 0.19
39 0.2
40 0.22
41 0.25
42 0.24
43 0.23
44 0.27
45 0.24
46 0.27
47 0.35
48 0.34
49 0.35
50 0.37
51 0.4
52 0.36
53 0.39
54 0.4
55 0.33
56 0.36
57 0.35
58 0.33
59 0.31
60 0.32
61 0.33
62 0.34
63 0.35
64 0.37
65 0.39
66 0.42
67 0.5
68 0.56
69 0.6
70 0.65
71 0.66
72 0.64
73 0.59
74 0.55
75 0.47
76 0.43
77 0.37
78 0.31
79 0.36
80 0.37
81 0.38
82 0.4
83 0.38
84 0.33
85 0.34
86 0.3