Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6V8D3

Protein Details
Accession A0A5N6V8D3    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
30-60ARHLNYSSKKRGKSKKERKKRRSQGVGIARLBasic
NLS Segment(s)
PositionSequence
38-52KKRGKSKKERKKRRS
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
Amino Acid Sequences MYWYSKYPSVLGTLLLPILFSPYRTQVTLARHLNYSSKKRGKSKKERKKRRSQGVGIARLYSIRPKPATRCVSGVTCVTLHQHTINIPLQMDRHLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.11
4 0.07
5 0.11
6 0.1
7 0.1
8 0.12
9 0.16
10 0.18
11 0.18
12 0.21
13 0.21
14 0.27
15 0.34
16 0.36
17 0.33
18 0.32
19 0.32
20 0.37
21 0.39
22 0.4
23 0.41
24 0.44
25 0.49
26 0.57
27 0.66
28 0.71
29 0.75
30 0.81
31 0.82
32 0.86
33 0.92
34 0.92
35 0.94
36 0.93
37 0.93
38 0.91
39 0.84
40 0.83
41 0.8
42 0.77
43 0.66
44 0.56
45 0.45
46 0.36
47 0.32
48 0.28
49 0.21
50 0.2
51 0.22
52 0.25
53 0.3
54 0.4
55 0.44
56 0.41
57 0.42
58 0.4
59 0.39
60 0.38
61 0.34
62 0.26
63 0.21
64 0.19
65 0.2
66 0.17
67 0.17
68 0.15
69 0.16
70 0.15
71 0.2
72 0.23
73 0.22
74 0.21
75 0.22
76 0.22