Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6V4X3

Protein Details
Accession A0A5N6V4X3    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-50TSHRPGTEWKKEKRRSSRPPAIWSHydrophilic
NLS Segment(s)
PositionSequence
36-42KKEKRRS
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MPTEQVNNPSGDTAMTIKAHGCERNSTSHRPGTEWKKEKRRSSRPPAIWSLSACASIAQVLADFVQRVPFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.13
5 0.15
6 0.18
7 0.19
8 0.19
9 0.21
10 0.22
11 0.31
12 0.34
13 0.37
14 0.38
15 0.39
16 0.38
17 0.36
18 0.42
19 0.42
20 0.48
21 0.51
22 0.55
23 0.61
24 0.69
25 0.75
26 0.78
27 0.8
28 0.8
29 0.83
30 0.85
31 0.81
32 0.8
33 0.76
34 0.7
35 0.61
36 0.51
37 0.44
38 0.34
39 0.28
40 0.22
41 0.16
42 0.12
43 0.1
44 0.09
45 0.06
46 0.05
47 0.05
48 0.06
49 0.07
50 0.07
51 0.07