Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6V1P9

Protein Details
Accession A0A5N6V1P9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
60-79DPVSKHRRGSHRNHGSCRNHBasic
NLS Segment(s)
Subcellular Location(s) extr 20, mito 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASATSANHATSVAKMLVSNVVAAVVPFGISVGVATTLVSHVAVRRSSERRCVAALERSDPVSKHRRGSHRNHGSCRNHLNGSDESVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.13
5 0.12
6 0.11
7 0.08
8 0.08
9 0.07
10 0.07
11 0.06
12 0.04
13 0.04
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.04
25 0.04
26 0.04
27 0.04
28 0.05
29 0.08
30 0.08
31 0.1
32 0.15
33 0.19
34 0.21
35 0.29
36 0.31
37 0.3
38 0.3
39 0.31
40 0.3
41 0.32
42 0.32
43 0.27
44 0.25
45 0.25
46 0.26
47 0.24
48 0.26
49 0.29
50 0.31
51 0.35
52 0.42
53 0.5
54 0.57
55 0.66
56 0.71
57 0.73
58 0.78
59 0.79
60 0.81
61 0.77
62 0.77
63 0.75
64 0.69
65 0.61
66 0.54
67 0.52
68 0.44