Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6UBH1

Protein Details
Accession A0A5N6UBH1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRLLFREKGKRRHMSKWAYNCLRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, plas 5, E.R. 5, golg 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MRLLFREKGKRRHMSKWAYNCLRNVLCLVEMLFVHLSCDIGTLVLILWCLEYSTTGSFNQTDPHDKIDCSWNLFPFEAETAVGWIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.81
4 0.82
5 0.79
6 0.77
7 0.69
8 0.66
9 0.56
10 0.47
11 0.38
12 0.28
13 0.21
14 0.17
15 0.16
16 0.1
17 0.09
18 0.1
19 0.09
20 0.08
21 0.08
22 0.07
23 0.07
24 0.06
25 0.06
26 0.05
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.04
39 0.05
40 0.06
41 0.08
42 0.08
43 0.1
44 0.11
45 0.11
46 0.15
47 0.16
48 0.21
49 0.21
50 0.25
51 0.25
52 0.25
53 0.26
54 0.31
55 0.31
56 0.31
57 0.33
58 0.31
59 0.33
60 0.33
61 0.31
62 0.25
63 0.24
64 0.18
65 0.16
66 0.13