Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6UKR8

Protein Details
Accession A0A5N6UKR8    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKRKKSSRQPQGPKKREPLPTTBasic
NLS Segment(s)
PositionSequence
3-17KRKKSSRQPQGPKKR
Subcellular Location(s) nucl 12, mito 10.5, cyto_mito 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003746  F:translation elongation factor activity  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRQPQGPKKREPLPTTFACLFCNHENSIVVKLDKKLGLGNLSCKVCGQRFQTGINYLSAAVDVYSDWVDACDAVAKDTANRYEDSNSAGLRSNEYTVSSSGQDAEYDDEDRAGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.88
3 0.85
4 0.83
5 0.77
6 0.73
7 0.68
8 0.62
9 0.6
10 0.55
11 0.47
12 0.39
13 0.35
14 0.33
15 0.29
16 0.3
17 0.24
18 0.22
19 0.23
20 0.22
21 0.24
22 0.22
23 0.19
24 0.18
25 0.19
26 0.21
27 0.19
28 0.19
29 0.17
30 0.16
31 0.19
32 0.18
33 0.2
34 0.22
35 0.22
36 0.22
37 0.2
38 0.21
39 0.19
40 0.23
41 0.23
42 0.23
43 0.24
44 0.26
45 0.28
46 0.28
47 0.28
48 0.23
49 0.19
50 0.14
51 0.12
52 0.1
53 0.07
54 0.05
55 0.04
56 0.03
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.07
66 0.07
67 0.07
68 0.08
69 0.08
70 0.1
71 0.13
72 0.16
73 0.14
74 0.15
75 0.16
76 0.18
77 0.18
78 0.2
79 0.2
80 0.17
81 0.17
82 0.2
83 0.18
84 0.2
85 0.2
86 0.19
87 0.17
88 0.19
89 0.19
90 0.17
91 0.19
92 0.16
93 0.15
94 0.15
95 0.15
96 0.13
97 0.13
98 0.15
99 0.15
100 0.15
101 0.15