Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UG67

Protein Details
Accession A0A179UG67    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-39GYRSRYKSVVHKKVQKHGRKBasic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto_nucl 2, nucl 1.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039024  RTC4  
IPR028094  RTC4_C  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
KEGG bgh:BDBG_02420  -  
Pfam View protein in Pfam  
PF14474  RTC4  
Amino Acid Sequences MEQAMARCRRFLKFACDFPGYRSRYKSVVHKKVQKHGRKILSRSVLHRTGYYGLRGHGIFSEHVVSHFKDAIDSLAGIDSVVSKYGTVVYAQVLVPEPLEMLVREDMGVDAKGARRILKESNKMGNLLNLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.52
4 0.49
5 0.49
6 0.53
7 0.48
8 0.45
9 0.44
10 0.41
11 0.41
12 0.45
13 0.5
14 0.52
15 0.58
16 0.62
17 0.67
18 0.7
19 0.75
20 0.82
21 0.8
22 0.78
23 0.77
24 0.77
25 0.76
26 0.73
27 0.72
28 0.71
29 0.64
30 0.59
31 0.57
32 0.51
33 0.44
34 0.41
35 0.34
36 0.29
37 0.27
38 0.26
39 0.2
40 0.16
41 0.17
42 0.17
43 0.15
44 0.12
45 0.12
46 0.1
47 0.1
48 0.11
49 0.08
50 0.09
51 0.11
52 0.1
53 0.1
54 0.11
55 0.1
56 0.09
57 0.09
58 0.09
59 0.07
60 0.07
61 0.06
62 0.05
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.05
69 0.05
70 0.04
71 0.05
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.08
78 0.08
79 0.09
80 0.09
81 0.09
82 0.08
83 0.08
84 0.07
85 0.06
86 0.07
87 0.06
88 0.08
89 0.08
90 0.08
91 0.08
92 0.09
93 0.09
94 0.09
95 0.09
96 0.07
97 0.09
98 0.11
99 0.15
100 0.16
101 0.19
102 0.19
103 0.23
104 0.32
105 0.4
106 0.46
107 0.5
108 0.57
109 0.57
110 0.56
111 0.54