Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6UPZ1

Protein Details
Accession A0A5N6UPZ1    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-29GINPLAPYPPQKKKKLKEQNRERLKEEDHydrophilic
NLS Segment(s)
PositionSequence
13-18KKKKLK
Subcellular Location(s) plas 7, E.R. 6, mito 5, nucl 4.5, cyto_nucl 3.5, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGINPLAPYPPQKKKKLKEQNRERLKEEDLKVVEHRVRCRFSFASPSLLFHCSVIFSFLFFFILFSSFHPLWGICIVLMRFLTDDSPLVVYKYQDILLGIASLGVWVSDSTLSKKLSCEYKLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.83
3 0.86
4 0.88
5 0.89
6 0.91
7 0.92
8 0.92
9 0.89
10 0.82
11 0.75
12 0.69
13 0.67
14 0.57
15 0.55
16 0.45
17 0.42
18 0.39
19 0.4
20 0.39
21 0.34
22 0.38
23 0.37
24 0.39
25 0.37
26 0.42
27 0.38
28 0.36
29 0.4
30 0.35
31 0.36
32 0.32
33 0.34
34 0.3
35 0.3
36 0.27
37 0.19
38 0.18
39 0.1
40 0.1
41 0.1
42 0.08
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.07
49 0.05
50 0.06
51 0.06
52 0.06
53 0.12
54 0.11
55 0.12
56 0.12
57 0.12
58 0.11
59 0.11
60 0.11
61 0.05
62 0.07
63 0.07
64 0.08
65 0.08
66 0.07
67 0.07
68 0.07
69 0.08
70 0.07
71 0.07
72 0.07
73 0.08
74 0.08
75 0.09
76 0.1
77 0.1
78 0.11
79 0.12
80 0.12
81 0.11
82 0.11
83 0.1
84 0.1
85 0.09
86 0.08
87 0.06
88 0.05
89 0.04
90 0.04
91 0.03
92 0.03
93 0.03
94 0.04
95 0.06
96 0.08
97 0.12
98 0.17
99 0.19
100 0.2
101 0.22
102 0.27
103 0.33