Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6V1E3

Protein Details
Accession A0A5N6V1E3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
17-44SLAAYRNMSCRRRRRCRRRVRLAVTGGAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 10
Family & Domain DBs
Amino Acid Sequences MLIHPKRRRTITSPVVSLAAYRNMSCRRRRRCRRRVRLAVTGGACFRDKLGNHFGCVVGRRGWCELVVVAVGVVHAHHGVAGSHGSIDNSLGWEGHYVLLDTFLLIFLCSLDRTGLCAVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.51
3 0.44
4 0.39
5 0.31
6 0.26
7 0.2
8 0.18
9 0.23
10 0.3
11 0.37
12 0.45
13 0.53
14 0.58
15 0.69
16 0.8
17 0.85
18 0.88
19 0.92
20 0.94
21 0.95
22 0.95
23 0.91
24 0.89
25 0.81
26 0.76
27 0.66
28 0.56
29 0.45
30 0.35
31 0.28
32 0.19
33 0.16
34 0.14
35 0.13
36 0.16
37 0.25
38 0.24
39 0.24
40 0.25
41 0.25
42 0.21
43 0.22
44 0.2
45 0.14
46 0.14
47 0.14
48 0.15
49 0.15
50 0.14
51 0.13
52 0.11
53 0.08
54 0.07
55 0.05
56 0.04
57 0.04
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.04
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.06
79 0.06
80 0.07
81 0.08
82 0.08
83 0.08
84 0.08
85 0.07
86 0.08
87 0.08
88 0.07
89 0.06
90 0.06
91 0.06
92 0.05
93 0.05
94 0.05
95 0.06
96 0.07
97 0.07
98 0.09
99 0.09
100 0.12