Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q75E99

Protein Details
Accession Q75E99    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
369-395QCKFGVKCTNKRCKYRHARSHIMCREGHydrophilic
NLS Segment(s)
PositionSequence
152-171GLKRGGKQGGINKSASGPRK
Subcellular Location(s) cyto_nucl 9.333, cyto 8.5, cyto_mito 8.166, nucl 8, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040366  Nab2/ZC3H14  
IPR043094  Nab2/ZC3H14_N_sf  
IPR021083  Nab2_N  
IPR041044  Nab2p_Zf1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0008097  F:5S rRNA binding  
GO:0008312  F:7S RNA binding  
GO:0046872  F:metal ion binding  
GO:0008143  F:poly(A) binding  
GO:0033204  F:ribonuclease P RNA binding  
GO:0000049  F:tRNA binding  
GO:0006378  P:mRNA polyadenylation  
GO:1900364  P:negative regulation of mRNA polyadenylation  
GO:1900152  P:negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay  
GO:0016973  P:poly(A)+ mRNA export from nucleus  
GO:0045945  P:positive regulation of transcription by RNA polymerase III  
GO:0043488  P:regulation of mRNA stability  
KEGG ago:AGOS_AAR178C  -  
Pfam View protein in Pfam  
PF11517  Nab2  
PF18260  Nab2p_Zf1  
PF14608  zf-CCCH_2  
Amino Acid Sequences MSAIQDDISGSLKTVVAEKLKTLQNFSEDVNYVAEYIVLLLSNGGTHDSVLQELVGLFDSVPQQALADVVQTSFQALQLLRSGDNIETVYQKLTNPGMMAPEPPAEAMSVSAPSEPSVSTEATSMPRSAFEGMVDLSASKYATKNPTSSRGGLKRGGKQGGINKSASGPRKGNQQTGGKHRMNALARALGMEGEDAANNAQVNIIPKKEGRCQLFPRCPLGKFCPHAHPTKVCRDYPNCPNAPGTCEYLHPNEDVELMKEIEKTREEFREKRIALAQSRAKPIQTGIVLCKFGIMCSNPMCPFGHPTPANEDAKVIQFIWCPQNLTCDKKDCDKAHSSLSKIRDVQPIAAAPRPSKPAAFAPAERSLEQCKFGVKCTNKRCKYRHARSHIMCREGAACTRIDCFFGHPINEPCKFGAECRNAHCLFQHPPGRSLPDKSQAATGAPSWPAHAAGGNQSANERPYAVAESAGIEQAPIQESDGDATMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.21
4 0.22
5 0.23
6 0.29
7 0.34
8 0.36
9 0.37
10 0.35
11 0.34
12 0.35
13 0.35
14 0.34
15 0.29
16 0.28
17 0.25
18 0.22
19 0.19
20 0.17
21 0.15
22 0.08
23 0.08
24 0.07
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.06
31 0.07
32 0.06
33 0.07
34 0.08
35 0.09
36 0.09
37 0.09
38 0.09
39 0.08
40 0.08
41 0.08
42 0.07
43 0.07
44 0.06
45 0.08
46 0.1
47 0.09
48 0.1
49 0.09
50 0.09
51 0.08
52 0.09
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.08
60 0.08
61 0.08
62 0.1
63 0.1
64 0.12
65 0.15
66 0.17
67 0.15
68 0.16
69 0.17
70 0.14
71 0.16
72 0.15
73 0.13
74 0.13
75 0.14
76 0.15
77 0.14
78 0.14
79 0.16
80 0.17
81 0.16
82 0.15
83 0.15
84 0.17
85 0.16
86 0.17
87 0.15
88 0.15
89 0.14
90 0.14
91 0.13
92 0.1
93 0.09
94 0.09
95 0.08
96 0.08
97 0.08
98 0.08
99 0.08
100 0.08
101 0.09
102 0.08
103 0.09
104 0.11
105 0.11
106 0.11
107 0.11
108 0.13
109 0.15
110 0.16
111 0.15
112 0.13
113 0.13
114 0.14
115 0.15
116 0.13
117 0.11
118 0.11
119 0.1
120 0.1
121 0.1
122 0.08
123 0.07
124 0.07
125 0.07
126 0.07
127 0.08
128 0.12
129 0.19
130 0.21
131 0.26
132 0.29
133 0.36
134 0.39
135 0.42
136 0.45
137 0.45
138 0.47
139 0.49
140 0.51
141 0.51
142 0.54
143 0.53
144 0.45
145 0.44
146 0.47
147 0.48
148 0.45
149 0.39
150 0.32
151 0.32
152 0.37
153 0.36
154 0.34
155 0.29
156 0.27
157 0.37
158 0.4
159 0.41
160 0.42
161 0.46
162 0.47
163 0.53
164 0.6
165 0.51
166 0.49
167 0.47
168 0.47
169 0.41
170 0.38
171 0.31
172 0.23
173 0.22
174 0.21
175 0.18
176 0.12
177 0.1
178 0.07
179 0.06
180 0.04
181 0.04
182 0.04
183 0.04
184 0.05
185 0.05
186 0.05
187 0.04
188 0.05
189 0.09
190 0.1
191 0.11
192 0.11
193 0.13
194 0.17
195 0.23
196 0.28
197 0.3
198 0.35
199 0.42
200 0.51
201 0.56
202 0.55
203 0.56
204 0.53
205 0.49
206 0.47
207 0.45
208 0.42
209 0.39
210 0.39
211 0.41
212 0.41
213 0.43
214 0.43
215 0.44
216 0.42
217 0.48
218 0.49
219 0.43
220 0.45
221 0.45
222 0.48
223 0.49
224 0.52
225 0.43
226 0.39
227 0.39
228 0.34
229 0.33
230 0.29
231 0.24
232 0.17
233 0.17
234 0.19
235 0.19
236 0.19
237 0.16
238 0.14
239 0.12
240 0.12
241 0.11
242 0.1
243 0.09
244 0.09
245 0.09
246 0.11
247 0.11
248 0.12
249 0.13
250 0.14
251 0.17
252 0.23
253 0.28
254 0.29
255 0.34
256 0.42
257 0.41
258 0.41
259 0.42
260 0.4
261 0.36
262 0.41
263 0.42
264 0.37
265 0.41
266 0.4
267 0.35
268 0.3
269 0.29
270 0.26
271 0.21
272 0.18
273 0.17
274 0.19
275 0.2
276 0.19
277 0.2
278 0.15
279 0.14
280 0.15
281 0.13
282 0.12
283 0.14
284 0.17
285 0.17
286 0.19
287 0.19
288 0.17
289 0.21
290 0.2
291 0.26
292 0.23
293 0.24
294 0.28
295 0.34
296 0.34
297 0.29
298 0.28
299 0.22
300 0.23
301 0.22
302 0.17
303 0.12
304 0.12
305 0.15
306 0.17
307 0.17
308 0.17
309 0.16
310 0.24
311 0.27
312 0.32
313 0.33
314 0.36
315 0.37
316 0.42
317 0.51
318 0.44
319 0.47
320 0.47
321 0.46
322 0.48
323 0.5
324 0.46
325 0.43
326 0.45
327 0.44
328 0.41
329 0.43
330 0.41
331 0.38
332 0.36
333 0.33
334 0.33
335 0.29
336 0.3
337 0.27
338 0.22
339 0.25
340 0.27
341 0.25
342 0.23
343 0.23
344 0.24
345 0.28
346 0.31
347 0.29
348 0.3
349 0.36
350 0.38
351 0.36
352 0.34
353 0.34
354 0.31
355 0.31
356 0.26
357 0.25
358 0.23
359 0.26
360 0.33
361 0.36
362 0.44
363 0.52
364 0.63
365 0.66
366 0.75
367 0.78
368 0.79
369 0.83
370 0.84
371 0.84
372 0.82
373 0.85
374 0.82
375 0.88
376 0.83
377 0.76
378 0.64
379 0.55
380 0.48
381 0.4
382 0.35
383 0.25
384 0.2
385 0.16
386 0.19
387 0.18
388 0.17
389 0.16
390 0.17
391 0.21
392 0.23
393 0.24
394 0.27
395 0.32
396 0.38
397 0.39
398 0.37
399 0.32
400 0.34
401 0.32
402 0.3
403 0.35
404 0.35
405 0.38
406 0.41
407 0.49
408 0.45
409 0.45
410 0.43
411 0.39
412 0.37
413 0.42
414 0.44
415 0.38
416 0.41
417 0.44
418 0.49
419 0.47
420 0.48
421 0.45
422 0.48
423 0.48
424 0.45
425 0.45
426 0.4
427 0.37
428 0.33
429 0.28
430 0.22
431 0.22
432 0.21
433 0.19
434 0.18
435 0.17
436 0.16
437 0.16
438 0.14
439 0.17
440 0.24
441 0.23
442 0.22
443 0.23
444 0.25
445 0.24
446 0.24
447 0.19
448 0.13
449 0.16
450 0.19
451 0.18
452 0.16
453 0.15
454 0.17
455 0.17
456 0.17
457 0.14
458 0.1
459 0.1
460 0.12
461 0.13
462 0.11
463 0.11
464 0.11
465 0.12
466 0.14