Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6UQC6

Protein Details
Accession A0A5N6UQC6    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-29RGNQRDQDRIKNQKKAQKKKTANTLSGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007513  SERF-like_N  
Pfam View protein in Pfam  
PF04419  4F5  
Amino Acid Sequences MTRGNQRDQDRIKNQKKAQKKKTANTLSGTQYQQKKESDAEIMRRKQANANASKVGSDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.77
3 0.82
4 0.82
5 0.83
6 0.83
7 0.83
8 0.81
9 0.85
10 0.83
11 0.76
12 0.69
13 0.63
14 0.55
15 0.51
16 0.45
17 0.4
18 0.37
19 0.35
20 0.36
21 0.32
22 0.3
23 0.27
24 0.27
25 0.28
26 0.27
27 0.34
28 0.38
29 0.41
30 0.45
31 0.46
32 0.45
33 0.45
34 0.47
35 0.47
36 0.45
37 0.47
38 0.45
39 0.43
40 0.44
41 0.4