Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6UPG5

Protein Details
Accession A0A5N6UPG5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
7-35MESWVRRLFKTPKKWPRSSRAPIRHREISHydrophilic
NLS Segment(s)
PositionSequence
18-27PKKWPRSSRA
Subcellular Location(s) mito 19.5, mito_nucl 12.333, nucl 4, cyto_nucl 3.833
Family & Domain DBs
Amino Acid Sequences MFVAAMMESWVRRLFKTPKKWPRSSRAPIRHREISQYKNRSDTWWTPNTSSIRMYIHSSSKFNWIVDNYFRCTMTHGALVPISGKKRLGLGGRSINQFTFGPDNHSGRFINIIIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.41
3 0.52
4 0.6
5 0.67
6 0.76
7 0.85
8 0.86
9 0.85
10 0.86
11 0.86
12 0.86
13 0.85
14 0.85
15 0.83
16 0.82
17 0.8
18 0.7
19 0.69
20 0.66
21 0.64
22 0.65
23 0.64
24 0.58
25 0.55
26 0.54
27 0.48
28 0.47
29 0.45
30 0.41
31 0.4
32 0.4
33 0.37
34 0.42
35 0.41
36 0.36
37 0.3
38 0.25
39 0.2
40 0.19
41 0.21
42 0.17
43 0.2
44 0.2
45 0.21
46 0.2
47 0.24
48 0.25
49 0.22
50 0.22
51 0.18
52 0.19
53 0.23
54 0.25
55 0.22
56 0.22
57 0.23
58 0.21
59 0.22
60 0.21
61 0.18
62 0.17
63 0.14
64 0.14
65 0.13
66 0.13
67 0.13
68 0.14
69 0.14
70 0.15
71 0.15
72 0.14
73 0.16
74 0.2
75 0.23
76 0.23
77 0.28
78 0.35
79 0.39
80 0.42
81 0.41
82 0.37
83 0.35
84 0.32
85 0.28
86 0.25
87 0.2
88 0.24
89 0.29
90 0.32
91 0.3
92 0.34
93 0.31
94 0.27
95 0.3