Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6UPX9

Protein Details
Accession A0A5N6UPX9    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-41VWRGTKSGTSRLKRHLRRKGPISQIIYHydrophilic
NLS Segment(s)
PositionSequence
26-33LKRHLRRK
Subcellular Location(s) mito 13, cyto 8.5, cyto_nucl 6.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032157  PAC4  
Gene Ontology GO:0043248  P:proteasome assembly  
Pfam View protein in Pfam  
PF16093  PAC4  
Amino Acid Sequences MVAKAQKSEEWTRFVWRGTKSGTSRLKRHLRRKGPISQIIYPPSMATAVEASIPPQVENLAPHAKPQELSFPLPKALHTTAHIHLTLLGTCATVFLATSTPGDSAGSVKPMGSFVYAMPDRTNPRNTISTTLYNLPGSVEYTIRIAKILARRMTVPVYVGCSIDPTALGLLVEEEMEGLTKIVEVIMQRWEQSRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.38
4 0.39
5 0.39
6 0.46
7 0.42
8 0.49
9 0.55
10 0.56
11 0.6
12 0.65
13 0.72
14 0.73
15 0.8
16 0.82
17 0.82
18 0.84
19 0.85
20 0.85
21 0.84
22 0.82
23 0.77
24 0.72
25 0.67
26 0.61
27 0.54
28 0.45
29 0.35
30 0.27
31 0.21
32 0.15
33 0.1
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.09
40 0.09
41 0.08
42 0.08
43 0.08
44 0.08
45 0.09
46 0.13
47 0.17
48 0.16
49 0.18
50 0.2
51 0.2
52 0.19
53 0.2
54 0.22
55 0.2
56 0.23
57 0.24
58 0.24
59 0.26
60 0.26
61 0.25
62 0.23
63 0.21
64 0.19
65 0.19
66 0.22
67 0.2
68 0.22
69 0.22
70 0.17
71 0.16
72 0.16
73 0.13
74 0.1
75 0.08
76 0.06
77 0.06
78 0.06
79 0.05
80 0.04
81 0.04
82 0.03
83 0.04
84 0.04
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.05
91 0.07
92 0.06
93 0.08
94 0.07
95 0.07
96 0.07
97 0.08
98 0.08
99 0.07
100 0.07
101 0.05
102 0.12
103 0.12
104 0.13
105 0.13
106 0.17
107 0.2
108 0.24
109 0.27
110 0.22
111 0.26
112 0.29
113 0.3
114 0.31
115 0.31
116 0.29
117 0.29
118 0.3
119 0.27
120 0.24
121 0.22
122 0.18
123 0.15
124 0.13
125 0.11
126 0.09
127 0.08
128 0.1
129 0.11
130 0.1
131 0.1
132 0.09
133 0.12
134 0.18
135 0.25
136 0.26
137 0.27
138 0.28
139 0.31
140 0.33
141 0.29
142 0.25
143 0.18
144 0.2
145 0.19
146 0.18
147 0.16
148 0.15
149 0.15
150 0.14
151 0.12
152 0.09
153 0.08
154 0.08
155 0.08
156 0.06
157 0.06
158 0.06
159 0.06
160 0.05
161 0.04
162 0.04
163 0.05
164 0.05
165 0.04
166 0.04
167 0.04
168 0.05
169 0.04
170 0.06
171 0.07
172 0.08
173 0.14
174 0.16
175 0.17