Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6V4A3

Protein Details
Accession A0A5N6V4A3    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
56-83QYSTGIHYLKPRKKNSRFESTPNRPQQIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEYSKRGLSHKSLFQTRKDVMSYWVFMFFSDISEMIMHATRVHPKTYMPTKAQSMQYSTGIHYLKPRKKNSRFESTPNRPQQIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.59
3 0.54
4 0.51
5 0.46
6 0.39
7 0.34
8 0.33
9 0.31
10 0.25
11 0.24
12 0.2
13 0.18
14 0.19
15 0.15
16 0.12
17 0.1
18 0.09
19 0.08
20 0.08
21 0.08
22 0.07
23 0.07
24 0.06
25 0.06
26 0.07
27 0.13
28 0.14
29 0.15
30 0.14
31 0.15
32 0.22
33 0.28
34 0.32
35 0.29
36 0.31
37 0.34
38 0.39
39 0.42
40 0.37
41 0.34
42 0.31
43 0.31
44 0.29
45 0.26
46 0.27
47 0.23
48 0.22
49 0.27
50 0.34
51 0.4
52 0.48
53 0.57
54 0.62
55 0.72
56 0.82
57 0.81
58 0.83
59 0.81
60 0.81
61 0.82
62 0.81
63 0.82
64 0.81