Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6E510

Protein Details
Accession A0A5N6E510    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-22AYPIHKRTRGGTKPNNPNITVHydrophilic
111-130TSTAQEQKPSKPRRARIFSKHydrophilic
NLS Segment(s)
PositionSequence
118-127KPSKPRRARI
Subcellular Location(s) nucl 13.5, mito_nucl 13.166, mito 11.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MAYPIHKRTRGGTKPNNPNITVPRPAMTRRSLHDTNCVHTQPVFTRTVLMREKQPKATLRLGQPKRPPNYYGSVWWTSTRASPDEQREKVEDKEAIRQSWLRRLRPRPSSTSTAQEQKPSKPRRARIFSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.85
3 0.83
4 0.74
5 0.7
6 0.67
7 0.62
8 0.57
9 0.47
10 0.41
11 0.39
12 0.4
13 0.39
14 0.37
15 0.35
16 0.34
17 0.41
18 0.41
19 0.4
20 0.46
21 0.43
22 0.42
23 0.43
24 0.4
25 0.32
26 0.29
27 0.3
28 0.24
29 0.26
30 0.24
31 0.18
32 0.21
33 0.2
34 0.26
35 0.27
36 0.25
37 0.29
38 0.35
39 0.38
40 0.38
41 0.43
42 0.4
43 0.42
44 0.46
45 0.43
46 0.42
47 0.5
48 0.5
49 0.52
50 0.55
51 0.58
52 0.56
53 0.54
54 0.48
55 0.41
56 0.43
57 0.38
58 0.33
59 0.31
60 0.3
61 0.28
62 0.27
63 0.24
64 0.2
65 0.2
66 0.19
67 0.15
68 0.16
69 0.21
70 0.29
71 0.37
72 0.37
73 0.38
74 0.39
75 0.4
76 0.39
77 0.39
78 0.33
79 0.27
80 0.34
81 0.35
82 0.32
83 0.32
84 0.35
85 0.33
86 0.39
87 0.45
88 0.44
89 0.51
90 0.59
91 0.65
92 0.71
93 0.74
94 0.72
95 0.71
96 0.69
97 0.64
98 0.62
99 0.59
100 0.57
101 0.53
102 0.55
103 0.52
104 0.55
105 0.61
106 0.62
107 0.66
108 0.68
109 0.75
110 0.77