Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179UUW3

Protein Details
Accession A0A179UUW3    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
78-97NKTSMRRRAANKKVRSKAGKHydrophilic
NLS Segment(s)
PositionSequence
83-95RRRAANKKVRSKA
Subcellular Location(s) cyto 9.5, cyto_nucl 9.333, cyto_mito 8.666, nucl 7, mito 6.5
Family & Domain DBs
Amino Acid Sequences MVESKPKVEELLNAPKHQGAKSGVWGAGTSIPSSSNYCTPYSVVPAVIHAQHRCLFFFLRSKIKICKLASLSKGLLANKTSMRRRAANKKVRSKAGKDVAVWNQGLCLEVVVDQASWSQNKVARLGATLHCH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.41
4 0.36
5 0.34
6 0.27
7 0.25
8 0.29
9 0.32
10 0.29
11 0.27
12 0.26
13 0.22
14 0.21
15 0.19
16 0.14
17 0.11
18 0.11
19 0.13
20 0.15
21 0.15
22 0.15
23 0.17
24 0.18
25 0.18
26 0.19
27 0.18
28 0.2
29 0.18
30 0.16
31 0.13
32 0.14
33 0.15
34 0.16
35 0.18
36 0.15
37 0.17
38 0.19
39 0.2
40 0.19
41 0.19
42 0.17
43 0.16
44 0.22
45 0.23
46 0.26
47 0.27
48 0.29
49 0.32
50 0.35
51 0.4
52 0.35
53 0.36
54 0.33
55 0.37
56 0.36
57 0.35
58 0.31
59 0.26
60 0.29
61 0.24
62 0.22
63 0.17
64 0.18
65 0.19
66 0.25
67 0.27
68 0.3
69 0.33
70 0.37
71 0.45
72 0.53
73 0.6
74 0.63
75 0.69
76 0.74
77 0.77
78 0.8
79 0.79
80 0.73
81 0.72
82 0.7
83 0.64
84 0.56
85 0.56
86 0.52
87 0.5
88 0.45
89 0.35
90 0.27
91 0.23
92 0.22
93 0.15
94 0.1
95 0.06
96 0.06
97 0.07
98 0.06
99 0.06
100 0.06
101 0.08
102 0.1
103 0.11
104 0.11
105 0.15
106 0.18
107 0.2
108 0.22
109 0.24
110 0.22
111 0.24
112 0.27