Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6F3T0

Protein Details
Accession A0A5N6F3T0    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-21DCPARRFPLRRPANHVPPIPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR025702  OXD  
Gene Ontology GO:0016829  F:lyase activity  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF13816  Dehydratase_hem  
Amino Acid Sequences MDCPARRFPLRRPANHVPPIPRWYTHFPNGLDRVFTAYIGIQRHDGLDIGLTQCLAAIELWLAETQNGAPAAVERFQVIDGDDAPDSLVFVCYWDTEPKYEKGIKALNLTQLYQKLDKSIQPTVGLWCERFVSHVSRLETNYSGTDYLPGLARLPSTKTVEHSYSAYWGAARDRIPDSAFDLFERDENPSAAAIPDPMSTTLGRHLTGTNLHNVVHIRSGQFWNNCDEDEKRSYEDKLEPTLREGLSYLWQNPAETGSMGLRYLSNVPTFSPAWSGQSNESCVTGFFRSLADLETWAKKHPSHLAIYTGAIRHAKTFGDRRKFRTWHEVSVLKSGDAYFEYLNCLPGTGMIKCVSLTEVSDLRPRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.79
4 0.75
5 0.73
6 0.72
7 0.67
8 0.58
9 0.54
10 0.54
11 0.55
12 0.55
13 0.54
14 0.5
15 0.55
16 0.59
17 0.53
18 0.47
19 0.39
20 0.38
21 0.31
22 0.28
23 0.2
24 0.17
25 0.2
26 0.21
27 0.21
28 0.17
29 0.17
30 0.18
31 0.17
32 0.15
33 0.11
34 0.1
35 0.11
36 0.11
37 0.1
38 0.09
39 0.09
40 0.09
41 0.08
42 0.08
43 0.06
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.06
50 0.05
51 0.06
52 0.06
53 0.09
54 0.09
55 0.08
56 0.08
57 0.09
58 0.12
59 0.13
60 0.13
61 0.1
62 0.11
63 0.11
64 0.11
65 0.1
66 0.09
67 0.08
68 0.1
69 0.1
70 0.09
71 0.09
72 0.08
73 0.08
74 0.07
75 0.07
76 0.05
77 0.06
78 0.06
79 0.07
80 0.09
81 0.13
82 0.14
83 0.17
84 0.21
85 0.22
86 0.27
87 0.3
88 0.29
89 0.3
90 0.34
91 0.34
92 0.35
93 0.36
94 0.36
95 0.34
96 0.34
97 0.32
98 0.3
99 0.31
100 0.28
101 0.25
102 0.22
103 0.23
104 0.25
105 0.26
106 0.26
107 0.25
108 0.24
109 0.25
110 0.24
111 0.26
112 0.24
113 0.2
114 0.17
115 0.16
116 0.15
117 0.15
118 0.15
119 0.15
120 0.18
121 0.23
122 0.25
123 0.26
124 0.27
125 0.28
126 0.27
127 0.23
128 0.2
129 0.16
130 0.14
131 0.12
132 0.12
133 0.1
134 0.1
135 0.09
136 0.08
137 0.08
138 0.08
139 0.08
140 0.08
141 0.1
142 0.13
143 0.15
144 0.16
145 0.18
146 0.21
147 0.22
148 0.22
149 0.21
150 0.18
151 0.17
152 0.17
153 0.14
154 0.1
155 0.1
156 0.09
157 0.11
158 0.11
159 0.12
160 0.13
161 0.14
162 0.15
163 0.14
164 0.16
165 0.15
166 0.15
167 0.12
168 0.12
169 0.11
170 0.11
171 0.11
172 0.1
173 0.09
174 0.09
175 0.09
176 0.08
177 0.08
178 0.08
179 0.07
180 0.06
181 0.06
182 0.06
183 0.06
184 0.07
185 0.08
186 0.08
187 0.08
188 0.11
189 0.12
190 0.11
191 0.12
192 0.12
193 0.12
194 0.16
195 0.16
196 0.16
197 0.16
198 0.15
199 0.16
200 0.17
201 0.16
202 0.14
203 0.14
204 0.11
205 0.13
206 0.16
207 0.2
208 0.21
209 0.21
210 0.23
211 0.22
212 0.22
213 0.22
214 0.21
215 0.21
216 0.22
217 0.23
218 0.22
219 0.24
220 0.24
221 0.26
222 0.29
223 0.27
224 0.3
225 0.32
226 0.29
227 0.3
228 0.34
229 0.3
230 0.25
231 0.23
232 0.18
233 0.18
234 0.2
235 0.18
236 0.17
237 0.17
238 0.17
239 0.17
240 0.17
241 0.14
242 0.11
243 0.12
244 0.09
245 0.09
246 0.09
247 0.09
248 0.08
249 0.09
250 0.11
251 0.12
252 0.12
253 0.12
254 0.12
255 0.16
256 0.16
257 0.16
258 0.17
259 0.16
260 0.18
261 0.19
262 0.2
263 0.21
264 0.23
265 0.25
266 0.22
267 0.22
268 0.19
269 0.18
270 0.19
271 0.16
272 0.13
273 0.11
274 0.11
275 0.11
276 0.11
277 0.12
278 0.1
279 0.11
280 0.14
281 0.19
282 0.19
283 0.21
284 0.24
285 0.23
286 0.27
287 0.33
288 0.34
289 0.34
290 0.36
291 0.37
292 0.35
293 0.36
294 0.34
295 0.27
296 0.26
297 0.23
298 0.21
299 0.18
300 0.19
301 0.19
302 0.23
303 0.32
304 0.38
305 0.48
306 0.53
307 0.59
308 0.67
309 0.71
310 0.7
311 0.71
312 0.67
313 0.64
314 0.66
315 0.63
316 0.56
317 0.59
318 0.54
319 0.42
320 0.38
321 0.29
322 0.24
323 0.2
324 0.2
325 0.13
326 0.12
327 0.17
328 0.17
329 0.19
330 0.17
331 0.16
332 0.14
333 0.17
334 0.2
335 0.16
336 0.18
337 0.18
338 0.19
339 0.18
340 0.19
341 0.17
342 0.14
343 0.15
344 0.17
345 0.18
346 0.2