Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q75AJ6

Protein Details
Accession Q75AJ6   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
182-205AVGKHAFHRRRGYHQGKKFKAQRRBasic
NLS Segment(s)
PositionSequence
185-205KHAFHRRRGYHQGKKFKAQRR
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, cyto 5.5, pero 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003034  SAP_dom  
IPR036361  SAP_dom_sf  
IPR040746  THO1_MOS11_C  
Gene Ontology GO:0005634  C:nucleus  
GO:0016973  P:poly(A)+ mRNA export from nucleus  
KEGG ago:AGOS_ADL069W  -  
Pfam View protein in Pfam  
PF02037  SAP  
PF18592  Tho1_MOS11_C  
PROSITE View protein in PROSITE  
PS50800  SAP  
Amino Acid Sequences MDIDHVASAARKAGATDATGWPWLANRQSHDEMTDYASMTVAQLKDVLKERELPTQGLKAALVERLQQADATAAEPTDATTRPAAEEHTPEAAEPAATPAEAEAPVAEQRAAAEPRTLSPEEMKQAAVAHLSKKLHRARKFGEDDAAVGALQKQLARLEKFGLDLTTQLAQELGFGRGPAAAVGKHAFHRRRGYHQGKKFKAQRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.17
4 0.18
5 0.19
6 0.19
7 0.19
8 0.17
9 0.17
10 0.2
11 0.22
12 0.23
13 0.25
14 0.32
15 0.35
16 0.36
17 0.35
18 0.33
19 0.29
20 0.29
21 0.26
22 0.19
23 0.16
24 0.15
25 0.13
26 0.12
27 0.14
28 0.11
29 0.09
30 0.12
31 0.12
32 0.16
33 0.21
34 0.23
35 0.2
36 0.27
37 0.29
38 0.34
39 0.35
40 0.33
41 0.3
42 0.31
43 0.31
44 0.25
45 0.23
46 0.16
47 0.15
48 0.15
49 0.13
50 0.12
51 0.13
52 0.13
53 0.13
54 0.12
55 0.11
56 0.1
57 0.1
58 0.08
59 0.07
60 0.06
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.08
67 0.08
68 0.09
69 0.09
70 0.1
71 0.11
72 0.11
73 0.13
74 0.13
75 0.14
76 0.13
77 0.12
78 0.13
79 0.1
80 0.09
81 0.07
82 0.06
83 0.05
84 0.05
85 0.05
86 0.04
87 0.05
88 0.05
89 0.05
90 0.03
91 0.04
92 0.05
93 0.05
94 0.05
95 0.04
96 0.05
97 0.09
98 0.1
99 0.09
100 0.1
101 0.1
102 0.11
103 0.16
104 0.16
105 0.13
106 0.14
107 0.16
108 0.17
109 0.18
110 0.17
111 0.13
112 0.13
113 0.13
114 0.13
115 0.11
116 0.11
117 0.15
118 0.16
119 0.17
120 0.25
121 0.32
122 0.39
123 0.44
124 0.5
125 0.5
126 0.59
127 0.63
128 0.56
129 0.52
130 0.43
131 0.38
132 0.32
133 0.27
134 0.17
135 0.12
136 0.11
137 0.07
138 0.08
139 0.07
140 0.08
141 0.11
142 0.17
143 0.19
144 0.19
145 0.21
146 0.21
147 0.22
148 0.22
149 0.19
150 0.14
151 0.13
152 0.14
153 0.14
154 0.13
155 0.11
156 0.1
157 0.09
158 0.1
159 0.12
160 0.11
161 0.09
162 0.09
163 0.1
164 0.1
165 0.1
166 0.09
167 0.1
168 0.08
169 0.1
170 0.12
171 0.14
172 0.19
173 0.29
174 0.32
175 0.38
176 0.48
177 0.51
178 0.58
179 0.67
180 0.73
181 0.74
182 0.8
183 0.84
184 0.81
185 0.86