Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6EPZ5

Protein Details
Accession A0A5N6EPZ5    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-37RSQTSDIKQKRQNSPRQRQKRNLQPKPRNLSSVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MPALRSQTSDIKQKRQNSPRQRQKRNLQPKPRNLSSVQRVRSPSNAVLRSKSYVPTVIAIPACPNCLRAPSTAVAISGRQDAVSRRSRFGSPVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.73
3 0.79
4 0.8
5 0.85
6 0.87
7 0.9
8 0.92
9 0.91
10 0.91
11 0.92
12 0.92
13 0.91
14 0.91
15 0.9
16 0.9
17 0.89
18 0.82
19 0.75
20 0.66
21 0.64
22 0.62
23 0.61
24 0.53
25 0.48
26 0.48
27 0.46
28 0.45
29 0.41
30 0.36
31 0.35
32 0.37
33 0.33
34 0.32
35 0.32
36 0.31
37 0.28
38 0.25
39 0.19
40 0.16
41 0.15
42 0.15
43 0.14
44 0.14
45 0.13
46 0.12
47 0.13
48 0.12
49 0.13
50 0.12
51 0.13
52 0.11
53 0.14
54 0.15
55 0.15
56 0.18
57 0.17
58 0.19
59 0.18
60 0.18
61 0.16
62 0.16
63 0.16
64 0.14
65 0.13
66 0.11
67 0.12
68 0.15
69 0.21
70 0.3
71 0.32
72 0.33
73 0.37
74 0.38
75 0.42