Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6EJE4

Protein Details
Accession A0A5N6EJE4    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
79-110KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MVSFRSLIAPSTGLFRQFLRKPLAGGFLARSFSQLTTLSLTNGLRALRAGKEQAGNVSVASTVRQLDQIRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.24
4 0.27
5 0.33
6 0.34
7 0.34
8 0.34
9 0.35
10 0.38
11 0.3
12 0.28
13 0.25
14 0.21
15 0.21
16 0.2
17 0.19
18 0.15
19 0.14
20 0.16
21 0.13
22 0.12
23 0.14
24 0.14
25 0.13
26 0.14
27 0.14
28 0.12
29 0.13
30 0.12
31 0.09
32 0.09
33 0.11
34 0.09
35 0.11
36 0.11
37 0.11
38 0.13
39 0.13
40 0.13
41 0.12
42 0.11
43 0.09
44 0.09
45 0.07
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.1
52 0.1
53 0.11
54 0.18
55 0.23
56 0.24
57 0.26
58 0.27
59 0.24
60 0.27
61 0.36
62 0.34
63 0.37
64 0.39
65 0.41
66 0.48
67 0.51
68 0.51
69 0.5
70 0.52
71 0.54
72 0.6
73 0.64
74 0.66
75 0.73
76 0.78
77 0.77
78 0.79
79 0.8
80 0.79
81 0.78
82 0.78
83 0.76
84 0.77
85 0.79
86 0.75
87 0.75
88 0.77
89 0.81
90 0.82