Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179V223

Protein Details
Accession A0A179V223    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
60-81IVITSDEKKEKKKKKKKKKNKKBasic
NLS Segment(s)
PositionSequence
67-81KKEKKKKKKKKKNKK
Subcellular Location(s) nucl 15, cyto 9, mito 2
Family & Domain DBs
Amino Acid Sequences MIQNIEKAALLSEHVNLLTAGMEPETADKKMRDFEMQVDLAEEKQQKPFSEMAAEGDFEIVITSDEKKEKKKKKKKKKNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.09
5 0.08
6 0.07
7 0.06
8 0.05
9 0.05
10 0.05
11 0.07
12 0.09
13 0.1
14 0.12
15 0.12
16 0.14
17 0.17
18 0.18
19 0.18
20 0.17
21 0.18
22 0.21
23 0.21
24 0.19
25 0.17
26 0.16
27 0.14
28 0.16
29 0.15
30 0.11
31 0.15
32 0.17
33 0.16
34 0.19
35 0.2
36 0.17
37 0.18
38 0.18
39 0.17
40 0.16
41 0.15
42 0.12
43 0.12
44 0.1
45 0.08
46 0.08
47 0.05
48 0.04
49 0.05
50 0.07
51 0.1
52 0.16
53 0.2
54 0.3
55 0.4
56 0.51
57 0.61
58 0.71
59 0.79
60 0.86
61 0.94