Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UND1

Protein Details
Accession A0A179UND1   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
208-233FDPRDLPSEQRKPPRRPQHPQWRLLAHydrophilic
NLS Segment(s)
PositionSequence
20-22KRM
Subcellular Location(s) nucl 13, mito 10, cyto 4
Family & Domain DBs
KEGG bgh:BDBG_05253  -  
Amino Acid Sequences MQAKRASRSQPPSPASNNRKRMIKLHEPWGKEVKGRSSMSRRYRMNIPPSLRGRGHDAQCGWRSPHTGTPRPATPPTTTGTPLPGTESPGTLQGQLTTPSMELEAGLRTGTTVAPSRVLMKPRKRHTPWKPYEVPGSLRGKLLTPFREEIKANLKSYASGLEQALRAEFEVLRSEIGTSMEALEGRLSAFETQANTQLEALEAKLALFDPRDLPSEQRKPPRRPQHPQWRLLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.72
3 0.74
4 0.75
5 0.71
6 0.74
7 0.71
8 0.7
9 0.69
10 0.69
11 0.65
12 0.67
13 0.67
14 0.63
15 0.65
16 0.65
17 0.58
18 0.5
19 0.49
20 0.45
21 0.46
22 0.45
23 0.48
24 0.5
25 0.57
26 0.63
27 0.67
28 0.63
29 0.59
30 0.65
31 0.65
32 0.65
33 0.64
34 0.59
35 0.59
36 0.61
37 0.63
38 0.55
39 0.49
40 0.48
41 0.47
42 0.46
43 0.42
44 0.4
45 0.4
46 0.42
47 0.44
48 0.38
49 0.32
50 0.32
51 0.29
52 0.35
53 0.36
54 0.4
55 0.41
56 0.43
57 0.45
58 0.47
59 0.47
60 0.42
61 0.37
62 0.32
63 0.3
64 0.28
65 0.27
66 0.22
67 0.22
68 0.2
69 0.18
70 0.19
71 0.17
72 0.18
73 0.17
74 0.17
75 0.15
76 0.17
77 0.17
78 0.14
79 0.13
80 0.1
81 0.11
82 0.12
83 0.11
84 0.09
85 0.09
86 0.08
87 0.08
88 0.07
89 0.06
90 0.05
91 0.05
92 0.05
93 0.05
94 0.04
95 0.04
96 0.05
97 0.05
98 0.05
99 0.07
100 0.07
101 0.08
102 0.09
103 0.12
104 0.14
105 0.2
106 0.26
107 0.33
108 0.42
109 0.47
110 0.58
111 0.6
112 0.68
113 0.72
114 0.76
115 0.74
116 0.74
117 0.72
118 0.64
119 0.64
120 0.56
121 0.48
122 0.44
123 0.42
124 0.34
125 0.3
126 0.28
127 0.24
128 0.25
129 0.27
130 0.22
131 0.22
132 0.23
133 0.24
134 0.27
135 0.26
136 0.27
137 0.3
138 0.33
139 0.3
140 0.3
141 0.28
142 0.25
143 0.25
144 0.25
145 0.17
146 0.14
147 0.13
148 0.13
149 0.14
150 0.14
151 0.13
152 0.1
153 0.1
154 0.09
155 0.09
156 0.08
157 0.1
158 0.1
159 0.1
160 0.1
161 0.1
162 0.1
163 0.11
164 0.1
165 0.08
166 0.08
167 0.08
168 0.08
169 0.08
170 0.07
171 0.07
172 0.06
173 0.06
174 0.07
175 0.06
176 0.07
177 0.08
178 0.1
179 0.12
180 0.18
181 0.19
182 0.19
183 0.18
184 0.18
185 0.17
186 0.15
187 0.14
188 0.09
189 0.08
190 0.07
191 0.07
192 0.08
193 0.09
194 0.09
195 0.1
196 0.12
197 0.14
198 0.17
199 0.18
200 0.23
201 0.32
202 0.4
203 0.47
204 0.56
205 0.64
206 0.7
207 0.79
208 0.85
209 0.86
210 0.87
211 0.89
212 0.9
213 0.9